KEGG   Bacillus subtilis subsp. subtilis 168: BSU22510
Entry
BSU22510          CDS       T00010                                 

Gene name
ypjC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YitT_membrane DUF2179
Other DBs
NCBI-GeneID: 939023
NCBI-ProteinID: NP_390132
Pasteur: BG11209
BSORF: BG11209
UniProt: P42978 A0A6M3ZDE2
Position
2360630..2361502
AA seq 290 aa
MLGEIRLKNIFFILIGAAIFSFGLVHFNMQNNLAEGGFTGITLLLYALFHISPSISNLVL
NIPIFFIGWRLLGRTMFVYTLVGTVALSLFLSIFQRYEIHMPLQHDLALAALFAGVFIGA
GLGIIFKFGGTTGGVDIIARLVNKYFGIPMGRTMFAFDACVIILSLLTYLSYKEAMYTLV
AVFVAARLIDFIQEGGYAAKGATIISSKNDLIQKKILEEMERGVTILKGQGSYTKEDIDV
LYCVVPKNELVMLKSVINSIDPHAFVAVSDVHDVLGEGFTLDENKNPLPR
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcttggagaaattagattaaaaaacatattttttattttaatcggagcggcaattttt
tcatttggcttggttcatttcaatatgcagaacaatctggctgagggcggttttacaggt
attacacttttgctttatgcccttttccacatcagcccctctatatcgaacctggtgttg
aacattccgattttttttattggctggcgtttgctcggcaggacaatgtttgtttatacc
cttgtcggcactgtagccttgtctttgttcctcagcatctttcagcgatatgaaatccat
atgccccttcagcacgacttagcgctcgccgctttatttgccggcgtattcatcggagcc
ggactgggtattatttttaagttcggcggtacgacaggcggtgttgatatcatcgcacgt
ttagtgaataagtattttgggattccgatgggcagaacgatgtttgctttcgatgcctgc
gtcatcattttgtctttgcttacttatctctcctataaagaagcgatgtatacgctggta
gctgtatttgtagcggcaagattaatcgattttattcaggaaggcggatacgctgctaaa
ggcgctacgatcatctcttcgaaaaacgacctgattcagaaaaagattcttgaagaaatg
gaacggggcgtcaccattttgaaaggacaaggttcctacacaaaagaggatatagatgta
ctttattgtgtggtgccgaaaaatgaattggtgatgctgaaaagcgtgattaactccatt
gatccccatgcctttgtagcggtaagcgatgttcacgatgtgctcggagaaggatttacg
cttgatgaaaataaaaatccgcttccgcgctga

DBGET integrated database retrieval system