KEGG   Bacillus subtilis subsp. subtilis 168: BSU22520
Entry
BSU22520          CDS       T00010                                 

Gene name
ypjB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Spore_YpjB
Other DBs
NCBI-GeneID: 939020
NCBI-ProteinID: NP_390133
Pasteur: BG11500
BSORF: BG11500
UniProt: P54393 A0A6M4JKB5
Position
complement(2361544..2362338)
AA seq 264 aa
MKRKLTICLLIALIFYNGNAKAAERGSLEELNDLSDTVFQMTRQAKYEEALQVLEYFEKT
LKSAEKKQQDPMLTGAQIRQITLGYNDMVRSLKQADTSDTQKLRAAAQFRMLMDAVDNRS
DPLWGSLEKPIMEAFTELKRDVQKNGSTSFHEKWNEFISLYDLIYPSLTIDVSEDQLETV
GKHIDVIEQEEFQQMTESTKLERLSLLQHDLKNVFDRVEEDDADPSLLWVIITTGSIIIT
ALTYVGYRKYKAEKNKLKKRDYPK
NT seq 795 nt   +upstreamnt  +downstreamnt
atgaaacgaaagctgacgatctgtttgttgattgcacttattttttataatggaaatgcc
aaggctgcagagcggggaagcctcgaggaattgaatgatttatccgatacagtctttcaa
atgacccgacaggcgaaatatgaagaggcgcttcaagtcttggagtattttgaaaaaaca
ttaaaatccgctgagaaaaaacagcaagaccccatgctaacgggagcccaaattcgtcaa
atcacattgggctataatgatatggttcggagtttaaagcaagctgatacatcagacaca
caaaaactcagagcagccgcgcagttcagaatgctgatggatgcggttgacaatcggtct
gacccgctttggggctcactggaaaaaccgattatggaagcttttactgaactgaagcga
gatgtccaaaagaatggaagcacaagctttcatgaaaaatggaatgaatttatcagttta
tatgacttgatttaccccagtcttacaatcgatgtatcagaggatcagcttgaaacagtc
ggaaaacatatagatgttattgagcaagaggaatttcagcaaatgacagagagcacgaag
cttgaacggctttcccttcttcagcatgacctgaaaaatgtgtttgacagggtggaggag
gatgatgccgatccgtctttactctgggtgatcattacaaccggcagtatcatcattact
gctcttacctatgtcggttacagaaagtacaaggcggaaaaaaacaagctgaaaaaaagg
gactaccctaaataa

DBGET integrated database retrieval system