KEGG   Bacillus subtilis subsp. subtilis 168: BSU22530
Entry
BSU22530          CDS       T00010                                 

Symbol
ypjA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1405 DUF3995 VPDSG-CTERM
Other DBs
NCBI-GeneID: 939018
NCBI-ProteinID: NP_390134
Pasteur: BG11499
BSORF: BG11499
UniProt: P54392
Position
complement(2362407..2362964)
AA seq 185 aa
MLILVLAINFLGTVYGYYWYLPQLLETPARFLIFVPDSPTATFFFLFVLLAFLMKRNAPL
LEALALVTLVKYGLWAVAMNFLVLAVTGDLPWEGYMLIASHFAMAVQGVLYSPYFRFSFW
HLAIAAVWTLHNDVIDYLFDMMPQYSMLSDYMTEIGYGTFWLSIFSIALAYFLVVSKKQT
KLELM
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcttattcttgtcttagccattaattttctgggaacggtttacggctactattggtac
ttgccgcagcttttggagacaccggcccgtttcctgatttttgttccggacagtccgaca
gcaacgtttttctttctgtttgtgctgcttgcctttctcatgaaacggaatgctccgctt
ttagaggcgcttgcgctagttaccctcgtaaagtatggcctatgggcggtggctatgaat
tttcttgtgcttgcagtaactggtgacttgccgtgggagggctacatgctaattgcttcg
cattttgcaatggcagttcaaggcgtattatacagtccgtattttcgtttttcattttgg
catcttgcaattgctgcagtctggacactgcataacgatgtcattgactacttgtttgat
atgatgccgcaatactctatgctttctgattatatgactgaaataggatacggaacattt
tggctaagtatcttttcaatcgcgcttgcttactttcttgtggtctcaaaaaagcaaacg
aagcttgagctgatgtaa

DBGET integrated database retrieval system