KEGG   Bacillus subtilis subsp. subtilis 168: BSU22540
Entry
BSU22540          CDS       T00010                                 

Gene name
qcrC
Definition
(RefSeq) menaquinol-cytochrome c reductase cytochrome b/c subunit
  KO
K03888  menaquinol-cytochrome c reductase cytochrome b/c subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU22540 (qcrC)
SSDB
Motif
Pfam: Cytochrome_CBB3 Cytochrom_B_C Cytochrom_C MFS_1 TctB DUF4131
Other DBs
NCBI-GeneID: 939021
NCBI-ProteinID: NP_390135
Pasteur: BG11327
BSORF: BG11327
UniProt: P46913 A0A6M3ZD91
Position
complement(2363111..2363878)
AA seq 255 aa
MHRGKGMKFVGDSRIPAEKKPNIPKDYSEYPGKTEAFWPNFLLKEWMVGAVFLIGFLVLT
IVHQPPLERMADPTDTGYIPLPDWYFLFLYQLLKYEYAAGSFTVVGAMIMPGLAFGALLL
APFLDRGTERRPWKRPVAVGMMLLAISAAVFLTWQSVATHDWAKAEEQGKITKEADIDTN
AEGYKVFKEQGCISCHGDNLQGGAAGPSLVDSGLKPDEIKKIAVEGKGKMPAGVFKGNDK
QLEELAKFISETTAK
NT seq 768 nt   +upstreamnt  +downstreamnt
atgcaccggggcaaagggatgaaatttgtaggcgactcaaggataccggctgaaaaaaag
ccgaatataccgaaggattattcggagtatccgggtaaaacagaggctttctggccaaat
ttcttgttaaaggaatggatggttggagctgtctttctcatcggttttctcgttttgacg
attgtgcatcagccgcctttagagcggatggcggacccgactgatactggttatattccg
ctgccggattggtattttcttttcttataccagctgttgaagtatgaatacgccgccgga
agctttacagtggtcggcgccatgattatgccaggtctcgcttttggggccctgcttttg
gctccattcctagacagagggacagaaagaaggccgtggaagcgtccggtcgctgtcggt
atgatgcttctggccatttccgctgctgtatttttgacgtggcagtcagttgctactcat
gactgggccaaggcagaagaacaggggaaaattacaaaagaagccgacattgacaccaat
gcagaaggatataaggtttttaaggaacagggctgtatttcttgccatggggataacctt
cagggaggagcggccgggccttcattggttgacagcgggctgaaaccggatgaaatcaaa
aaaatcgctgtagaagggaaaggcaaaatgccggcgggtgtgttcaaaggaaatgataag
cagctcgaagaacttgcaaaatttatttctgaaacaaccgcaaaataa

DBGET integrated database retrieval system