KEGG   Bacillus subtilis subsp. subtilis 168: BSU22550
Entry
BSU22550          CDS       T00010                                 

Gene name
qcrB
Definition
(RefSeq) menaquinol-cytochrome c reductase cytochrome b subunit
  KO
K03887  menaquinol-cytochrome c reductase cytochrome b subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU22550 (qcrB)
SSDB
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 Ni_hydr_CYTB DUF4405 DUF973 DUF373 DUF4079
Other DBs
NCBI-GeneID: 939019
NCBI-ProteinID: NP_390136
Pasteur: BG11326
BSORF: BG11326
UniProt: P46912 A0A6M3ZDG5
Position
complement(2363913..2364587)
AA seq 224 aa
MLNKIYDWVDERLDITPMWRDIADHEVPEHVNPAHHFSAFVYCFGGLTFFVTVIQVLSGM
FLTMYYVPDIKNAWESVYYLQNEVAFGQIVRGMHHWGASLVIVMMFLHTLRVFFQGAYKK
PRELNWIVGVLIFFVMLGLGFTGYLLPWDMKALFATKVGLQIAEATPLIGTQVKTLLAGH
PDIVGAQTLTRFFAIHVFFLPAALFGLMAAHFIMIRKQGISGPL
NT seq 675 nt   +upstreamnt  +downstreamnt
atgctgaacaaaatttatgactgggtagacgagcggcttgatattacaccgatgtggagg
gatattgccgatcacgaagtaccggaacatgtgaatcccgcccatcatttctctgcgttt
gtgtattgctttgggggactgacgttttttgtaaccgttatccaagtattatctggaatg
tttttaacgatgtattatgtgcctgatatcaaaaatgcctgggaatcggtatattatttg
caaaatgaagtggcattcggccagattgtcagggggatgcaccactggggtgcgagcctg
gtcattgtgatgatgtttttacatacgctgagggtctttttccaaggcgcgtataaaaaa
ccgcgcgagctgaactggattgtcggtgtgctgatcttttttgttatgctcggtcttggc
tttacaggctacttgcttccttgggatatgaaggctctgtttgcaacaaaagtcggactg
cagatcgccgaagccacgcctttgatcggaacgcaagttaaaacgctccttgcagggcat
ccggatattgtaggcgcccaaacgctgactaggttttttgcgatccatgtattttttctt
cctgccgcattgttcgggctgatggctgcacattttattatgatccggaagcaggggatt
tcaggaccgctttaa

DBGET integrated database retrieval system