KEGG   Bacillus subtilis subsp. subtilis 168: BSU22570
Entry
BSU22570          CDS       T00010                                 

Gene name
ypiF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2487
Other DBs
NCBI-GeneID: 939015
NCBI-ProteinID: NP_390138
Pasteur: BG11498
BSORF: BG11498
UniProt: P54391 A0A6M4JIQ8
Position
complement(2365235..2365681)
AA seq 148 aa
MRWRITDAKDYLQAKDYIDTAVIPLINIRVNNHFKMAAEKGEFTQLLSEELERQLKGRVY
LLPPYTYVDRNEITVQGLKDLREELITEFPHVVLLTSDESWRAEDALGKMIVTSSVPLEH
LNDSLKRKILDERTAEILNVLLQLWSTL
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaggtggagaatcactgatgccaaggactatttacaagctaaggattacattgatacc
gctgtcataccattaattaacataagggttaataaccattttaaaatggcggcggagaaa
ggcgagtttacgcagcttctctcagaagaacttgaaaggcagttaaagggacgggtatat
ttacttccgccttatacatatgttgatagaaatgaaataaccgttcaagggcttaaggat
ttgcgggaagagctgataacggaatttccgcatgttgtcctgctcacatctgacgaaagt
tggagagctgaggatgcgttaggcaaaatgattgttacatcgtctgttccattagagcat
ttaaatgactctttaaaaagaaaaatattggatgaacgcactgctgaaattttgaacgtt
ttgttacagttatggagcactttataa

DBGET integrated database retrieval system