KEGG   Bacillus subtilis subsp. subtilis 168: BSU22580
Entry
BSU22580          CDS       T00010                                 

Gene name
ypiB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UPF0302 IDEAL HAV_VP Gal4_dimer
Other DBs
NCBI-GeneID: 939016
NCBI-ProteinID: NP_390139
Pasteur: BG11497
BSORF: BG11497
UniProt: P54390 A0A6M3ZD32
Position
complement(2365736..2366275)
AA seq 179 aa
MQTPVSVNEKKDFIRWFLNHYQLKRRECVWILNYLMSHDSLMEKVHFVEQAEFCPRGIIM
STHCVEEVPFRFYKENVMTTDAEKSFHDIRLNKQQDLFIQLNFRSAYSSPEYAAVLESNP
HIPKNLFENKKDQGLAEQILEHAISTFQREKLLKDIDDALDRHDKEAFEQLSRQLNQLT
NT seq 540 nt   +upstreamnt  +downstreamnt
atgcagacccctgtttctgtcaatgagaaaaaagattttatccgttggtttttaaaccat
tatcagttaaagcgccgagagtgcgtttggatcttgaactacttaatgagccatgattct
ctcatggagaaggttcattttgtggagcaggctgaattttgcccgagaggcattataatg
tcaacacattgtgttgaagaagttccgttccggttctataaagagaatgtcatgactacc
gacgcggaaaaatcttttcatgatattagattaaataaacagcaggatttgtttatccag
cttaatttccgttcggcttacagctcacctgaatatgcggcggtgctggagtccaacccg
catattccgaaaaacctttttgagaataaaaaagatcagggattggcggaacagatttta
gagcacgctatttccacattccaaagagaaaaattattaaaagacattgacgacgcgtta
gatcgtcatgataaagaggcatttgaacaattatcgcgccaattaaatcagctcacataa

DBGET integrated database retrieval system