KEGG   Bacillus subtilis subsp. subtilis 168: BSU22590
Entry
BSU22590          CDS       T00010                                 

Gene name
ypiA
Definition
(RefSeq) TPR repeat-containing protein YpiA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TPR_19 TPR_14 TPR_2 TPR_8 TPR_16 ANAPC3 TPR_12 TPR_1 TPR_15 TPR_7 TPR_6 TPR_11 HrpB1_HrpK TPR_9 Suf PknG_TPR
Other DBs
NCBI-GeneID: 939012
NCBI-ProteinID: NP_390140
Pasteur: BG11496
BSORF: BG11496
UniProt: P54389 A0A6M4JN94
Position
complement(2366347..2367618)
AA seq 423 aa
MNTLIQEAIKLVEAGETEKGLNTLSKAEKQLHDEDKAIAAQLYYEWGDVEKAISLISDLH
DLYPNETELTNFYAELLIDIDEEEKALAVLETIPETDPSYPESLLLMADLYQMQGLFEVS
EQKLFQAKSILDNEPVIDFALGELYFAQGAYAKAVQYFKTTAEEQSEIGGVNVHQRLAES
LSASGEFEDAIPWYEKAVDENPDPNTIFGYGFTALQAGLVKTAIKQLSDLKELDPSYTSL
YMPLSKSYEAEGMYEEALKTAKEGIRYDEYNKELFLYAAKMALKIGKSEEGKKLLQEALA
LDPGFVEALHTLLAVYHKEEDYDQIIDLIQEVRSYGEEDPKYNWYLASAYTELEQYEEAK
QSFEAAYLHYREDRDFLYEYASFLLEEGLQKEALPLLKKVLEMDGANEELEETILRIEDE
FSR
NT seq 1272 nt   +upstreamnt  +downstreamnt
ttgaatacattgattcaagaagccataaaattagttgaagcaggtgaaacagaaaaaggc
ctcaacacgctctcgaaggctgaaaaacagctgcatgatgaagataaagccattgcagcc
cagctttattacgagtggggcgatgtagaaaaagccatttcactgattagtgatctacat
gatttatatccaaatgaaacagaactgacgaatttctacgctgaacttttaatagatatt
gacgaagaagaaaaagccctcgctgtgctggagactattccggaaacagatccatcatat
ccggaaagtttgctgcttatggcggatctttatcagatgcaggggttattcgaagtcagt
gaacaaaagcttttccaggcaaagtccattctggacaatgaacctgttattgattttgca
ctgggagaactttactttgctcagggagcctatgcaaaagcggttcaatattttaaaaca
acggctgaggagcagagtgagatcgggggcgttaatgtccatcaaagactggcagaatcg
ttaagtgcctcaggtgaatttgaggatgccattccatggtatgagaaagctgtcgatgag
aatcctgatcctaatacgattttcggctatggttttacagccttacaggcggggcttgtg
aaaacagctattaagcagctgtctgatttaaaggagcttgatccatcttatacttcactt
tatatgccgctctcgaaaagctatgaagctgaaggaatgtatgaagaggcattaaaaacg
gcaaaagaggggatcagatatgatgaatataacaaagaacttttcctttatgccgccaaa
atggccttgaaaatcgggaagtcagaagaggggaagaagctgcttcaggaggcgcttgcg
cttgatccgggctttgtcgaggcgcttcatacacttcttgccgtgtatcacaaagaagag
gattatgatcagatcattgatcttattcaagaggttcgaagctacggtgaagaagatcct
aaatacaattggtatcttgcaagcgcatatactgaattagagcaatacgaggaagcaaaa
caatcctttgaggctgcctatcttcattaccgggaggatagagatttcttatatgaatac
gcaagcttcctattagaagaaggtcttcaaaaagaagcgctgccgcttttgaaaaaggtt
cttgaaatggacggagccaatgaagagcttgaagaaacgattttgcgaatcgaggatgaa
ttttctagataa

DBGET integrated database retrieval system