KEGG   Bacillus subtilis subsp. subtilis 168: BSU22600
Entry
BSU22600          CDS       T00010                                 

Gene name
aroE
Definition
(RefSeq) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22600 (aroE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     BSU22600 (aroE)
SSDB
Motif
Pfam: EPSP_synthase
Other DBs
NCBI-GeneID: 939014
NCBI-ProteinID: NP_390141
Pasteur: BG10294
BSORF: BG10294
UniProt: P20691 A0A6M3ZGQ2
Position
complement(2367954..2369240)
AA seq 428 aa
MKRDKVQTLHGEIHIPGDKSISHRSVMFGALAAGTTTVKNFLPGADCLSTIDCFRKMGVH
IEQSSSDVVIHGKGIDALKEPESLLDVGNSGTTIRLMLGILAGRPFYSAVAGDESIAKRP
MKRVTEPLKKMGAKIDGRAGGEFTPLSVSGASLKGIDYVSPVASAQIKSAVLLAGLQAEG
TTTVTEPHKSRDHTERMLSAFGVKLSEDQTSVSIAGGQKLTAADIFVPGDISSAAFFLAA
GAMVPNSRIVLKNVGLNPTRTGIIDVLQNMGAKLEIKPSADSGAEPYGDLIIETSSLKAV
EIGGDIIPRLIDEIPIIALLATQAEGTTVIKDAAELKVKETNRIDTVVSELRKLGAEIEP
TADGMKVYGKQTLKGGAAVSSHGDHRIGMMLGIASCITEEPIEIEHTDAIHVSYPTFFEH
LNKLSKKS
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgaaacgagataaggtgcagaccttacatggagaaatacatattcccggtgataaatcc
atttctcaccgctctgttatgtttggcgcgctagcggcaggcacaacaacagttaaaaac
tttctgccgggagcagattgtctgagcacgatcgattgctttagaaaaatgggtgttcac
attgagcaaagcagcagcgatgtcgtgattcacggaaaaggaatcgatgccctgaaagag
ccagaaagccttttagatgtcggaaattcaggtacaacgattcgcctgatgctcggaata
ttggcgggccgtcctttttacagcgcggtagccggagatgagagcattgcgaaacgccca
atgaagcgtgtgactgagcctttgaaaaaaatgggggctaaaatcgacggcagagccggc
ggagagtttacaccgctgtcagtgagcggcgcttcattaaaaggaattgattatgtatca
cctgttgcaagcgcgcaaattaaatctgctgttttgctggccggattacaggctgagggc
acaacaactgtaacagagccccataaatctcgggaccacactgagcggatgctttctgct
tttggcgttaagctttctgaagatcaaacgagtgtttccattgctggtggccagaaactg
acagctgctgatatttttgttcctggagacatttcttcagccgcgtttttccttgctgct
ggcgcgatggttccaaacagcagaattgtattgaaaaacgtaggtttaaatccgactcgg
acaggtattattgatgtccttcaaaacatgggggcaaaacttgaaatcaaaccatctgct
gatagcggtgcagagccttatggagatttgattatagaaacgtcatctctaaaggcagtt
gaaatcggaggagatatcattccgcgtttaattgatgagatccctatcatcgcgcttctt
gcgactcaggcggaaggaaccaccgttattaaggacgcggcagagctaaaagtgaaagaa
acaaaccgtattgatactgttgtttctgagcttcgcaagctgggtgctgaaattgaaccg
acagcagatggaatgaaggtttatggcaaacaaacgttgaaaggcggcgctgcagtgtcc
agccacggagatcatcgaatcggaatgatgcttggtattgcttcctgtataacggaggag
ccgattgaaatcgagcacacggatgccattcacgtttcttatccaaccttcttcgagcat
ttaaataagctttcgaaaaaatcctga

DBGET integrated database retrieval system