KEGG   Bacillus subtilis subsp. subtilis 168: BSU22610Help
Entry
BSU22610          CDS       T00010                                 

Gene name
tyrA
Definition
(RefSeq) prephenate dehydrogenase
  KO
K04517  prephenate dehydrogenase [EC:1.3.1.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu00401  Novobiocin biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22610 (tyrA)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BSU22610 (tyrA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     BSU22610 (tyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH ACT ACT_6 ACT_4 TrkA_N ACT_7 SecD-TM1 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 939013
NCBI-ProteinID: NP_390142
Pasteur: BG10293
BSORF: BG10293
UniProt: P20692 A3F3C4
Position
complement(2369251..2370366)
Genome map
AA seq 371 aa AA seqDB search
MNQMKDTILLAGLGLIGGSIALAIKKNHPGKRIIGIDISDEQAVAALKLGVIDDRADSFI
SGVKEAATVIIATPVEQTLVMLEELAHSGIEHELLITDVGSTKQKVVDYADQVLPSRYQF
VGGHPMAGSHKSGVAAAKEFLFENAFYILTPGQKTDKQAVEQLKNLLKGTNAHFVEMSPE
EHDGVTSVISHFPHIVAASLVHQTHHSENLYPLVKRFAAGGFRDITRIASSSPAMWRDIL
LHNKDKILDRFDEWIREIDKIRTYVEQEDAENLFRYFKTAKDYRDGLPLRQKGAIPAFYD
LYVDVPDHPGVISEITAILAAERISITNIRIIETREDINGILRISFQSDDDRKRAEQCIE
ARAEYETFYAD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaatgaaagatacaatattgctcgccggtctcggattgataggcggttcgatt
gccctagccatcaaaaaaaatcatcccggcaaacggattatcggaatcgacatctctgat
gaacaggcggtagcggcattaaaattaggcgtgatagacgatcgtgctgattcgtttatt
agcggtgtgaaagaggcagctacagtaatcattgcgacacctgttgaacaaacactggtt
atgcttgaagagctggctcattcaggaattgaacatgagcttttgattacggatgtagga
agcacaaagcaaaaagtggttgattacgctgatcaagtgctgcctagccgctatcaattt
gtcggagggcatccgatggcgggttcacataaatcaggagtggccgctgcgaaggagttc
ctgtttgaaaatgcattttatattttaacgccaggccagaaaacggacaaacaagctgtg
gaacagttaaaaaacctgctgaaggggacgaatgcccattttgtggaaatgtcgccagag
gagcatgatggcgttacaagcgtaatcagtcattttccgcatattgtagcagctagcctt
gttcaccaaacccatcattcggaaaacctgtatccgcttgttaagcgttttgctgccggc
gggttcagagatattacaaggattgcatcaagcagcccggcaatgtggcgggatatttta
ttacataataaagataaaatcttagaccgttttgatgagtggattcgtgaaattgacaag
atccgtacatatgtagaacaagaagatgcggaaaatctatttcgttattttaaaacagcc
aaggattatcgcgacgggctgccgcttcggcagaagggagcgatacctgcattttatgat
ttatatgtggatgtacccgatcatccgggtgtaatatccgagataacagcgatcttagct
gcggagcgcatcagtatcacgaatatccgcattatcgaaacacgagaggatattaacggg
attttaaggatcagttttcagtctgatgacgaccgcaaaagggcagaacaatgcattgaa
gcccgggcggaatatgaaactttttatgctgattga

DBGET integrated database retrieval system