KEGG   Bacillus subtilis subsp. subtilis 168: BSU22620
Entry
BSU22620          CDS       T00010                                 

Symbol
hisC
Name
(RefSeq) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu00350  Tyrosine metabolism
bsu00360  Phenylalanine metabolism
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu00401  Novobiocin biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU22620 (hisC)
   00350 Tyrosine metabolism
    BSU22620 (hisC)
   00360 Phenylalanine metabolism
    BSU22620 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22620 (hisC)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BSU22620 (hisC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU22620 (hisC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     BSU22620 (hisC)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class II
   BSU22620 (hisC)
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 Alliinase_C
Other DBs
NCBI-GeneID: 939009
NCBI-ProteinID: NP_390143
Pasteur: BG10292
BSORF: BG10292
UniProt: P17731 A3F3C5
Position
complement(2370415..2371497)
AA seq 360 aa
MRIKEHLKQLKPYQPGKPIEAVKSEYGLDKVVKLASNENPYGCSEAAKEALHHEIQQLAL
YPDGYSAALRTRLSKHLNVSETSLIFGNGSDEIIQIICRAFLNDKTNTVTAAPTFPQYKH
NAVIEGAEVREIALRPDGSHDLDAMLEAIDEQTQVVWICSPNNPTGTYTSEGELLAFLER
VPSRVLVVLDEAYYEYVTAEDYPETVPLLSKYSNLMILRTFSKAYGLAALRVGYGIADEN
LIRQIEPAREPFNTSRLGQAAAIAALDDQAFIASCVEQNNAGLQQYYDFAKTHGLKCYPS
QTNFVLIDFKRPADELFQALLEKGYIVRSGNALGFPTSLRITIGTKEQNEEILAILAEIL
NT seq 1083 nt   +upstreamnt  +downstreamnt
ttgcgtatcaaagaacatttaaaacagctgaagccttatcagcctggaaagccgattgaa
gcagtgaaatcagaatatggcttggataaagttgtgaagcttgcttcaaacgagaatcct
tacggctgttcagaggctgcaaaagaggcgcttcatcatgagattcaacagctagccctt
tacccggacgggtatagcgccgctttgcggacaaggctcagtaagcacctcaatgtcagc
gaaacatcacttattttcggcaacggttctgatgaaatcatacagatcatctgccgggca
tttttaaacgataaaacaaacacggttactgctgcccccacttttccgcaatataaacat
aatgcggttattgaaggtgctgaagtacgtgaaattgcacttcgtcccgacggctcacat
gatttagacgccatgttagaagccatcgacgaacagacacaagtcgtttggatatgcagc
ccgaataatccgactggcacttatacatctgaaggagaattactcgcatttctggagcgc
gttccttctcgtgtccttgtcgttcttgacgaagcatattatgaatatgtaacagcagag
gattacccggaaaccgtgccgctcttaagcaagtattccaatttgatgattttgcgcaca
ttttcaaaggcatacggtctggcagcgctcagagtcggatacggaattgctgacgagaac
ctgattcgccagattgagccggcgagagagccgtttaataccagccgtctgggccaggct
gcggcgattgcagcacttgatgatcaagcgtttattgcttcctgtgtcgagcaaaataat
gcaggccttcagcagtattatgattttgcgaaaactcatggtttaaagtgctacccttca
cagacaaattttgtgttaattgactttaaacgtcctgctgatgaactgtttcaggctctg
ctggaaaaaggctatatcgtccggtcaggaaacgcattaggtttcccgacatcactccgg
attacgatcggaacaaaagagcaaaatgaagaaatacttgccattttagctgaaatttta
taa

DBGET integrated database retrieval system