KEGG   Bacillus subtilis subsp. subtilis 168: BSU22640
Entry
BSU22640          CDS       T00010                                 

Symbol
trpB
Name
(RefSeq) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU22640 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22640 (trpB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BSU22640 (trpB)
SSDB
Motif
Pfam: PALP DUF4147
Other DBs
NCBI-GeneID: 939010
NCBI-ProteinID: NP_390145
Pasteur: BG10290
BSORF: BG10290
UniProt: P07600 A3F3C7
Position
complement(2372304..2373506)
AA seq 400 aa
MYPYPNEIGRYGDFGGKFVPETLMQPLDEIQTAFKQIKDDPAFREEYYKLLKDYSGRPTA
LTYADRVTEYLGGAKIYLKREDLNHTGSHKINNALGQALLAKKMGKTKIIAETGAGQHGV
AAATVAAKFGFSCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNGTLKDATNEAIRYW
VQHCEDHFYMIGSVVGPHPYPQVVREFQKMIGEEAKDQLKRIEGTMPDKVVACVGGGSNA
MGMFQAFLNEDVELIGAEAAGKGIDTPLHAATISKGTVGVIHGSLTYLIQDEFGQIIEPY
SISAGLDYPGIGPEHAYLHKSGRVTYDSITDEEAVDALKLLSEKEGILPAIESAHALAKA
FKLAKGMDRGQLILVCLSGRGDKDVNTLMNVLEEEVKAHV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgtatccatatccgaatgaaataggcagatacggtgattttggcggaaagtttgttccg
gaaacactcatgcagccgttagatgaaatacaaacagcatttaaacaaatcaaggatgat
cccgcttttcgtgaagagtattataagctgttaaaggactattccggacgcccgactgca
ttaacatacgctgatcgagtcactgaatacttaggcggcgcgaaaatctatttgaaacga
gaagatttaaaccatacaggttctcataaaatcaataatgcgctaggtcaagcgctgctt
gctaaaaaaatgggcaaaacgaaaatcattgctgaaaccggtgccggccagcatggtgtt
gccgctgcaacagttgcagccaaattcggcttttcctgtactgtgtttatgggtgaagag
gatgttgcccgccagtctctgaacgttttccgcatgaagcttcttggagcggaggtagtg
cctgtaacaagcggaaacggaacattgaaggatgccacaaatgaggcgatccggtactgg
gttcagcattgtgaggatcacttttatatgattggatcagttgtcggcccgcatccttat
ccgcaagtggtccgtgaatttcaaaaaatgatcggagaggaagcgaaggatcagttgaaa
cgtattgaaggcactatgcctgataaagtagtggcatgtgtaggcggaggaagcaatgcg
atgggtatgtttcaggcatttttaaatgaagatgttgaactgatcggcgctgaagcagca
ggaaaaggaattgatacacctcttcatgccgccactatttcgaaaggaaccgtaggggtt
attcacggttcattgacttatctcattcaggatgagttcgggcaaattattgagccctac
tctatttcagccggtctcgactatcctggaatcggtccggagcatgcatatttgcataaa
agcggccgtgtcacttatgacagtataaccgatgaagaagcggtggatgcattaaagctt
ttgtcagaaaaagaggggattttgccggcaatcgaatctgcccatgcgttagcgaaagca
ttcaaactcgccaaaggaatggatcgcggtcaactcattctcgtctgtttatcaggccgg
ggagacaaggatgtcaacacattaatgaatgtattggaagaagaggtgaaagcccatgtt
taa

DBGET integrated database retrieval system