KEGG   Bacillus subtilis subsp. subtilis 168: BSU22650Help
Entry
BSU22650          CDS       T00010                                 

Gene name
trpF
Definition
(RefSeq) N-(5'-phosphoribosyl)anthranilate isomerase
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22650 (trpF)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     BSU22650 (trpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRAI RNB
Motif
Other DBs
NCBI-GeneID: 939006
NCBI-ProteinID: NP_390146
Pasteur: BG10289
BSORF: BG10289
UniProt: P20167 A3F3C8
Position
complement(2373487..2374134)
Genome map
AA seq 215 aa AA seqDB search
MKKPALKYCGIRSLKDLQLAAESQADYLGFIFAESKRKVSPEDVKKWLNQVRVEKQVAGV
FVNESIETMSRIAKSLKLDVIQLHGDEKPADAAALRKLTGCEIWKALHHQDNTTQEIARF
KDNVDGFVIDSSVKGSRGGTGVAFSWECVPEYQQAAIGKRCFIAGGVNPDSITRLLKWQP
EGIDLASGIEKNGQKDQNLMRLLEERMNRYVSISE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaccggcattaaaatattgcggtattcggtcactaaaggatttgcagcttgcg
gcggaatcacaggctgattacctaggatttatttttgctgaaagcaaacgaaaagtatct
ccggaagatgtgaaaaaatggctgaaccaagttcgtgtcgaaaaacaggttgcaggtgtt
tttgttaatgaatcaatagagacgatgtcacgtattgccaagagcttgaagctcgacgtc
attcagcttcacggtgatgaaaaaccggcggatgctgctgctcttcgcaagctgacaggc
tgtgaaatatggaaggcgcttcaccatcaagataacacaactcaagaaatagcccgcttt
aaagataatgttgacggctttgtgattgattcatctgtaaaagggtctagaggcggaact
ggtgttgcattttcttgggaatgtgtgccggaatatcagcaggcggctattggtaaacgc
tgctttatcgctggcggcgtgaatccggatagcatcacacgcctattgaaatggcagcca
gaaggaattgaccttgccagcggaattgaaaaaaacggacaaaaagatcagaatctgatg
aggcttttagaagaaaggatgaaccgatatgtatccatatccgaatga

DBGET integrated database retrieval system