KEGG   Bacillus subtilis subsp. subtilis 168: BSU22660
Entry
BSU22660          CDS       T00010                                 

Symbol
trpC
Name
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22660 (trpC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BSU22660 (trpC)
SSDB
Motif
Pfam: IGPS His_biosynth
Other DBs
NCBI-GeneID: 939004
NCBI-ProteinID: NP_390147
Pasteur: BG11038
BSORF: BG11038
UniProt: P03964 A3F3C9
Position
complement(2374139..2374888)
AA seq 249 aa
MLEKIIKQKKEEVKTLVLPVEQPFEKRSFKEALASPNRFIGLIAEVKKASPSKGLIKEDF
VPVQIAKDYEAAKADAISVLTDTPFFQGENSYLSDVKRAVSIPVLRKDFIDSLQVEESRR
IGADAILLIGEVLDPLHLHELYLEAGEKGMDVLVEVHDASTLEQILKVFTPDILGVNNRN
LKTFETSVKQTEQIASLVPKESLLVSESGIGSLEHLTFVNEHGARAVLIGESLMRQTSQR
KAIHALFRE
NT seq 750 nt   +upstreamnt  +downstreamnt
atgcttgaaaaaatcatcaaacaaaagaaagaagaagtgaaaacactggttctgccggta
gagcagcctttcgagaaacgttcatttaaggaggcgctggcaagcccgaatcggtttatc
gggttgattgccgaagtgaagaaagcatcgccgtcaaaagggcttattaaagaggatttt
gtacctgtgcagattgcaaaagactatgaggctgcgaaggcagatgcgatttccgtttta
acagacaccccgttttttcaaggggaaaacagctatttatcagacgtaaagcgtgctgtt
tcgattcctgtacttagaaaagattttattgattctcttcaagtagaggaatcaagaaga
atcggagcggatgccatattgttaatcggcgaggtgcttgatcccttacaccttcatgaa
ttatatcttgaagcaggtgaaaaggggatggacgtgttagtggaggttcatgatgcatca
acgctagaacaaatattgaaagtgttcacacccgacattctcggcgtaaataatcgaaac
ctaaaaacgtttgaaacatctgtaaagcagacagaacaaatcgcatctctcgttccgaaa
gaatccttgcttgtcagcgaaagcggaatcggttctttagaacatttaacatttgtcaat
gaacatggggcgcgagctgtacttatcggtgaatcattgatgagacaaacttctcagcgt
aaagcaatccatgctttgtttagggagtga

DBGET integrated database retrieval system