KEGG   Bacillus subtilis subsp. subtilis 168: BSU22670
Entry
BSU22670          CDS       T00010                                 

Gene name
trpD
Definition
(RefSeq) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22670 (trpD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     BSU22670 (trpD)
SSDB
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Other DBs
NCBI-GeneID: 939007
NCBI-ProteinID: NP_390148
Pasteur: BG10288
BSORF: BG10288
UniProt: P03947 A3F3D0
Position
complement(2374881..2375897)
AA seq 338 aa
MNRFLQLCVDGKTLTAGEAETLMNMMMAAEMTPSEMGGILSILAHRGETPEELAGFVKAM
RAHALTVDGLPDIVDTCGTGGDGISTFNISTASAIVASAAGAKIAKHGNRSVSSKSGSAD
VLEELEVSIQTTPEKVKSSIETNNMGFLFAPLYHSSMKHVAGTRKELGFRTVFNLLGPLS
NPLQAKRQVIGVYSVEKAGLMASALETFQPKHVMFVSSRDGLDELSITAPTDVIELKDGE
RREYTVSPEDFGFTNGRLEDLQVQSPKESAYLIQNIFENKSSSSALSITAFNAGAAIYTA
GITASLKEGTELALETITSGGAAAQLERLKQKEEEIYA
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaacagatttctacaattgtgcgttgacggaaaaacccttactgccggtgaggctgaa
acgctgatgaatatgatgatggcagcggaaatgactccttctgaaatgggggggatattg
tcaattcttgctcatcggggggagacgccagaagagcttgcgggttttgtgaaggcaatg
cgggcacacgctcttacagtcgatggacttcctgatattgttgatacatgcggaacaggg
ggagacggtatttccacttttaatatctcaacggcctcggcaattgttgcctcggcagct
ggtgcgaaaatcgctaagcatggcaatcgctctgtctcttctaaaagcggaagcgctgat
gttttagaggagctagaggtttctattcaaaccactcccgaaaaggtcaaaagcagcatt
gaaacaaacaacatgggatttctttttgcgccgctttaccattcgtctatgaaacatgta
gcaggtactagaaaagagctaggtttcagaacggtatttaatctgcttgggccgctcagc
aatcctttacaggcgaagcgtcaggtgattggggtctattctgttgaaaaagctggactg
atggcaagcgcactggagacgtttcagccgaagcacgttatgtttgtatcaagccgtgac
ggtttagatgagctttcaattacagcaccgaccgacgtgattgaattaaaggacggagag
cgccgggagtataccgtttcacccgaagatttcggtttcacaaatggcagacttgaagat
ttacaggtgcagtctccgaaagagagcgcttatctcattcagaatatttttgaaaataaa
agcagcagttccgctttatctattacggcttttaatgcgggtgctgcgatttacacggcg
ggaattaccgcctcactgaaggaaggaacggagctggcgttagagacgattacaagcgga
ggcgctgccgcgcagcttgaacgactaaagcagaaagaggaagagatctatgcttga

DBGET integrated database retrieval system