KEGG   Bacillus subtilis subsp. subtilis 168: BSU22680Help
Entry
BSU22680          CDS       T00010                                 

Gene name
trpE
Definition
(RefSeq) anthranilate synthase component 1
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01230  Biosynthesis of amino acids
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22680 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    BSU22680 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU22680 (trpE)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     BSU22680 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-GeneID: 939008
NCBI-ProteinID: NP_390149
Pasteur: BG10287
BSORF: BG10287
UniProt: P03963 A3F3D1
Position
complement(2375869..2377416)
Genome map
AA seq 515 aa AA seqDB search
MNFQSNISAFLEDSLSHHTIPIVETFTVDTLTPIQMIEKLDREITYLLESKDDTSTWSRY
SFIGLNPFLTIKEEQGRFSAADQDSKSLYTGNELKEVLNWMNTTYKIKTPELGIPFVGGA
VGYLSYDMIPLIEPSVPSHTKETDMEKCMLFVCRTLIAYDHETKNVHFIQYARLTGEETK
NEKMDVFHQNHLELQNLIEKMMDQKNIKELFLSADSYKTPSFETVSSNYEKSAFMADVEK
IKSYIKAGDIFQGVLSQKFEVPIKADAFELYRVLRIVNPSPYMYYMKLLDREIVGSSPER
LIHVQDGHLEIHPIAGTRKRGADKAEDERLKVELMKDEKEKAEHYMLVDLARNDIGRVAE
YGSVSVPEFTKIVSFSHVMHIISVVTGRLKKGVHPVDALMSAFPAGTLTGAPKIRAMQLL
QELEPTPRETYGGCIAYIGFDGNIDSCITIRTMSVKNGVASIQAGAGIVADSVPEAEYEE
SCNKAGALLKTIHIAEDMFHSKEDKADEQISTIVR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccaatcaaacatttccgcatttttagaggacagcttgtcccaccacacgata
ccgattgtggagaccttcacagtcgatacactgacacccattcaaatgatagagaagctt
gacagggagattacgtatcttcttgaaagcaaggacgatacatccacttggtccagatat
tcgtttatcggcctgaatccatttctcacaattaaagaagagcagggccgtttttcggcc
gctgatcaggacagcaaatctctttacacaggaaatgaactaaaagaagtgctgaactgg
atgaataccacatacaaaatcaaaacacctgagcttggcattccttttgtcggcggagct
gtcgggtacttaagctatgatatgatcccgctgattgagccttctgttccttcgcatacc
aaagaaacagacatggaaaagtgtatgctgtttgtttgccggacattaattgcgtatgat
catgaaaccaaaaacgtccactttatccaatatgcaaggctcactggagaggaaacaaaa
aacgaaaaaatggatgtattccatcaaaatcatctggagcttcaaaatctcattgaaaaa
atgatggaccaaaaaaacataaaagagctgtttctttctgctgattcatacaagacaccc
agctttgagacagtatcttctaattatgaaaaatcggcttttatggctgatgtagaaaaa
atcaaaagctatataaaagcaggcgatatcttccagggtgttttatcacaaaaatttgag
gtgccgataaaagcagatgcttttgagttataccgagtgcttaggatcgtcaatccttcg
ccgtatatgtattatatgaaactgctagacagagaaatagtcggcagctctccggaacgg
ttaatacacgttcaagacgggcacttagaaatccatccgattgccggtacgagaaaacgc
ggtgcagacaaagctgaagatgagagactgaaggttgagctcatgaaggatgaaaaagaa
aaagcggagcattacatgctcgttgatcttgcccgaaacgatatcggcagagtagcagag
tatggttctgtttctgtgccggagttcacaaaaattgtttccttttcacatgtcatgcac
attatctcggtggttacaggccgattgaaaaaaggggttcatcctgtcgatgcactgatg
tctgctttcccggcggggactttaacaggcgcacccaaaatccgtgccatgcagcttttg
caagaactcgagccaacaccgagagagacatacggagggtgtattgcctacattgggttt
gacgggaatatcgactcttgtattacgattcgcacgatgagtgtaaagaacggtgttgca
tcgatacaggcaggtgctggcattgttgctgattctgttccggaagccgaatacgaagaa
agctgtaataaagccggtgcgctgctgaaaacgattcatattgcagaagacatgtttcat
agcaaggaggataaagctgatgaacagatttctacaattgtgcgttga

DBGET integrated database retrieval system