KEGG   Bacillus subtilis subsp. subtilis 168: BSU22710
Entry
BSU22710          CDS       T00010                                 

Gene name
aroF
Definition
(RefSeq) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22710 (aroF)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     BSU22710 (aroF)
SSDB
Motif
Pfam: Chorismate_synt
Other DBs
NCBI-GeneID: 939000
NCBI-ProteinID: NP_390152
Pasteur: BG10284
BSORF: BG10284
UniProt: P31104 A3F3D4
Position
complement(2379100..2380272)
AA seq 390 aa
MRYLTAGESHGPQLTTIIEGVPAGLYITEEDINFELARRQKGHGRGRRMQIEKDQAKIMS
GVRHARTLGSPIALVVENNDWKHWTKIMGAAPITEDEEKEMKRQISRPRPGHADLNGAIK
YNHRDMRNVLERSSARETTVRVAAGAVAKKILSELGIKVAGHVLQIGAVKAEKTEYTSIE
DLQRVTEESPVRCYDEEAGKKMMAAIDEAKANGDSIGGIVEVIVEGMPVGVGSYVHYDRK
LDSKLAAAVLSINAFKGVEFGIGFEAAGRNGSEVHDEIIWDEEKGYTRATNRLGGLEGGM
TTGMPIVVRGVMKPIPTLYKPLKSVDIETKEPFSASIERSDSCAVPAASVVAEAAVAWEI
ANAVVEQFGLDQIDRIRENVENMRKLSREF
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgagatatttaacagccggagaatcacacggcccccaactgacaaccattattgagggt
gtacctgccgggctttacataacggaggaagatatcaattttgagcttgccagacgccaa
aaaggacacggccgcggccgccgcatgcagatcgaaaaagaccaggccaaaattatgagc
ggggtgcgccatgcacgtacactcggttcgccaattgctctcgtagttgaaaataacgat
tggaagcattggacaaaaatcatgggcgccgctccgattacagaagatgaagaaaaggaa
atgaagcgccagatttccagaccgagacctgggcacgctgacttaaacggtgcaattaaa
tataatcatcgtgatatgagaaatgtgcttgagcgttcttcagcaagggaaacaactgtc
agagtggcggcaggggctgtagctaaaaagattctttctgagcttggcattaaggtggcg
ggccacgtgttgcaaattggcgctgttaaagctgaaaaaacagagtatacgtcaattgaa
gacttgcagcgtgtaacggaagagtctcctgtcagatgctacgatgaagaggcaggcaaa
aaaatgatggctgccattgatgaagcaaaggcaaacggagattccatcggcggaatagta
gaagtcattgtcgagggaatgccggtaggcgtgggcagctatgtccattatgaccgcaag
ctggatagcaagcttgctgccgctgttctgtcaattaacgcatttaaaggtgtggaattc
ggcatcggatttgaggcagcagggcgaaatggaagcgaagtccatgacgagatcatttgg
gacgaggaaaaaggatacacccgtgctactaacagacttggcggactggaaggcggcatg
acgacagggatgccgattgttgtccgcggagtcatgaagccgattccgactttgtataaa
ccgctgaaaagtgtcgatattgaaacgaaagaaccgttttctgccagcattgaacgttca
gacagctgtgctgttcctgcggcaagtgtagtcgctgaagcggctgtcgcttgggaaatt
gcgaacgcagtcgttgaacaattcggattagatcaaattgaccgcattagagaaaatgtg
gagaatatgagaaaactgtcgagggaattttaa

DBGET integrated database retrieval system