KEGG   Bacillus subtilis subsp. subtilis 168: BSU22720
Entry
BSU22720          CDS       T00010                                 

Gene name
cheR
Definition
(RefSeq) chemotaxis protein methyltransferase
  KO
K00575  chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU22720 (cheR)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU22720 (cheR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU22720 (cheR)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     BSU22720 (cheR)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BSU22720 (cheR)
SSDB
Motif
Pfam: CheR CheR_N Methyltransf_31 Methyltransf_12 Methyltransf_25 Methyltransf_11 Methyltransf_23 NOP5NT
Other DBs
NCBI-GeneID: 939003
NCBI-ProteinID: NP_390153
Pasteur: BG10283
BSORF: BG10283
UniProt: P31105 A3F3D5
Structure
PDB: 
5FTW

Position
complement(2380347..2381117)
AA seq 256 aa
MDTYSVFTTKWKQLTGVDLTLYKEAQMKRRLTSLYEKKGFQSFKDFAAALEKDQALLNET
LDRMTINVSEFYRNYKRWEVLETAILPLIKTSRPLKIWSAACSTGEEPYTLAMLLDQQKG
LPGYQILATDIDEKALEKAKKGVYQERSLQEVPLSVKDRYFTQNANRSYEVKTEIKKNIT
FKKHNLLADRYEQDFDLIVCRNVFIYFTESAKEELYLKMAHSLKKNGVLFVGSTEQIFNP
EKFGLVPADTFFYQKR
NT seq 771 nt   +upstreamnt  +downstreamnt
atggatacatacagcgtatttacaacgaaatggaaacaattaaccggagtcgatttaaca
ctatataaagaagcacaaatgaagagaaggctaacgtcactttatgagaaaaaggggttc
caaagctttaaggactttgctgcggcattggaaaaggatcaagctctcttaaatgaaaca
ttggacagaatgacgatcaatgtttcagaattttatcgtaattataaaagatgggaagtt
cttgagactgcaattctgccgttaatcaagacctctaggcctttaaaaatttggagtgcc
gcctgctcaacgggggaggagccatacacgcttgccatgcttttggaccagcaaaaaggt
cttccgggctatcagattttagcgacggatattgatgaaaaagcattggaaaaagcgaaa
aaaggcgtttatcaggagcggtctttacaggaagtgccgctatctgtgaaagatcgttat
tttacgcaaaacgcaaatagaagttatgaagtgaaaacggaaatcaaaaagaatattaca
ttcaaaaagcacaatttgctggcggatcgttatgaacaagactttgacttaatcgtgtgc
cgcaatgtatttatttattttacagaaagcgcgaaggaagagctgtatttaaaaatggca
catagcttgaagaagaatggagttctttttgtcggcagcaccgagcaaatcttcaatccc
gagaaatttggcctagtcccagccgatacattcttttatcaaaaaagatag

DBGET integrated database retrieval system