KEGG   Bacillus subtilis subsp. subtilis 168: BSU22750
Entry
BSU22750          CDS       T00010                                 

Gene name
ubiE
Definition
(RefSeq) demethylmenaquinone methyltransferase
  KO
K03183  demethylmenaquinone methyltransferase / 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase [EC:2.1.1.163 2.1.1.201]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BSU22750 (ubiE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.163  demethylmenaquinone methyltransferase
     BSU22750 (ubiE)
    2.1.1.201  2-methoxy-6-polyprenyl-1,4-benzoquinol methylase
     BSU22750 (ubiE)
SSDB
Motif
Pfam: Ubie_methyltran Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 PCMT CMAS Methyltransf_4 MetW FtsJ MTS Methyltransf_8 Methyltransf_18
Other DBs
NCBI-GeneID: 938999
NCBI-ProteinID: NP_390156
Pasteur: BG10280
BSORF: BG10280
UniProt: P31113 A3F3D8
Position
complement(2382907..2383608)
AA seq 233 aa
MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTAD
WTIALAKAAGKSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYV
TIGFGLRNVPDYLTVLKEMRRVVKPGGQVVCLETSQPEMFGFRQAYFMYFKYIMPFFGKL
FAKSYKEYSWLQESARDFPGMKELAGLFEEAGLKNVKYHSFTGGVAATHIGWK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgcaggactcaaaagaacagcgcgtacacggagtatttgaaaaaatatataaaaattat
gaccaaatgaactctgtcatcagttttcagcagcataaaaaatggcgcgacaaaacgatg
cgcatcatgaatgtaaaggaaggcgcaaaagcacttgatgtctgctgcggaacggctgac
tggacgatcgctcttgcaaaagcggcaggcaaaagcggcgagatcaagggcttggatttc
agtgaaaatatgctgagtgtcggcgagcagaaagtaaaagacggcggattcagccaaatt
gaactgctgcacggaaatgcgatggagcttccttttgatgatgatacatttgattatgtc
accattggcttcggactccgcaatgtccctgattacttgactgtactgaaagagatgaga
cgtgtagtgaagccgggcgggcaggtggtatgtctggaaacgtcccagccggaaatgttc
ggattcagacaggcttactttatgtactttaagtatattatgccgtttttcgggaaactg
tttgcgaagagctataaagaatattcttggcttcaagaatcagccagagatttccctgga
atgaaggaactggcaggcctgtttgaagaggcgggcctgaaaaatgttaaatatcattcg
tttactggcggagtcgctgccacgcatatcggatggaaatga

DBGET integrated database retrieval system