KEGG   Bacillus subtilis subsp. subtilis 168: BSU22770
Entry
BSU22770          CDS       T00010                                 

Symbol
mtrB
Name
(RefSeq) transcription attenuation protein MtrB
  KO
K06285  transcription attenuation protein (tryptophan RNA-binding attenuator protein)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU22770 (mtrB)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU22770 (mtrB)
SSDB
Motif
Pfam: TrpBP Peptidase_S6
Other DBs
NCBI-GeneID: 938996
NCBI-ProteinID: NP_390158
Pasteur: BG10278
BSORF: BG10278
UniProt: P19466 A3F3E0
Structure
PDB: 
3ZZQ 1WAP 4B27

Position
complement(2384534..2384761)
AA seq 75 aa
MNQKHSSDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGE
ALIQTAYGEMKSEKK
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaaccaaaagcattcaagtgattttgtcgtcattaaagccgttgaggacggagtgaat
gtgatcggcctgacaagaggaacagacacaaagtttcaccattccgaaaaactcgacaag
ggagaagtgatcatcgctcagtttacagagcatacttctgccattaaagtcagaggagag
gcactgattcaaaccgcgtacggagaaatgaaaagcgaaaaaaaataa

DBGET integrated database retrieval system