KEGG   Bacillus subtilis subsp. subtilis 168: BSU22780
Entry
BSU22780          CDS       T00010                                 

Symbol
folE
Name
(RefSeq) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU22780 (folE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BSU22780 (folE)
SSDB
Motif
Pfam: GTP_cyclohydroI QueF Importin_rep_3
Other DBs
NCBI-GeneID: 938994
NCBI-ProteinID: NP_390159
Pasteur: BG10277
BSORF: BG10277
UniProt: P19465 A3F3E1
Position
complement(2384783..2385355)
AA seq 190 aa
MKEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDPKEHFQTIFG
ENHEELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPRGGKVTGLSKLARAVEAVAKRPQLQ
ERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGVFKDDAAARA
EVLEHIKRQD
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaaagaagttaataaagagcaaatcgaacaagctgttcgtcaaattttagaagcgatc
ggagaagacccgaatagagaagggcttcttgatactccgaaaagagtcgcaaagatgtat
gccgaagtattctccggcttgaatgaagatccaaaagaacatttccagactatcttcggt
gaaaaccatgaggagcttgttcttgtaaaagatatagcgtttcattctatgtgtgagcat
caccttgttcccttttatggaaaagcacatgttgcatatatcccgcgaggcggaaaggtc
acaggactcagcaaactggcacgtgccgttgaagccgttgcaaagcgcccgcagcttcag
gaacgcatcacttctacaattgcagaaagcatcgtagaaacgcttgatccgcatggcgta
atggtagtggttgaagcggaacacatgtgcatgacgatgcgcggtgtaagaaaaccgggt
gcgaaaactgtgacttcagcagtcagaggcgtttttaaagatgatgccgctgcccgtgca
gaagtattggaacatattaaacgccaggactaa

DBGET integrated database retrieval system