KEGG   Bacillus subtilis subsp. subtilis 168: BSU22790
Entry
BSU22790          CDS       T00010                                 

Symbol
hbs
Name
(RefSeq) DNA-binding protein HU 1
  KO
K03530  DNA-binding protein HU-beta
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU22790 (hbs)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU22790 (hbs)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU22790 (hbs)
DNA replication proteins [BR:bsu03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BSU22790 (hbs)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Nucleoid associated proteins
   HU (heat unstable protein)
    BSU22790 (hbs)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Supressor
      BSU22790 (hbs)
SSDB
Motif
Pfam: Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF3235 HU-DNA_bdg DUF2267 SIS_2
Other DBs
NCBI-GeneID: 938995
NCBI-ProteinID: NP_390160
Pasteur: BG10276
BSORF: BG10276
UniProt: P08821 A0A6M3ZDH9
Position
complement(2385543..2385821)
AA seq 92 aa
MNKTELINAVAEASELSKKDATKAVDSVFDTILDALKNGDKIQLIGFGNFEVRERSARKG
RNPQTGEEIEIPASKVPAFKPGKALKDAVAGK
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaacaaaacagaacttatcaatgcggttgcagaagcaagcgaattgtctaaaaaagac
gctacaaaagcagttgactctgtttttgatacgatcttagatgcacttaaaaacggtgat
aaaatccaactgatcggttttggtaacttcgaggtgcgtgaacgttctgcacgtaaagga
cgcaatcctcaaacaggtgaagaaatcgaaattccagcaagcaaagtacctgctttcaaa
ccaggtaaagcgcttaaagacgcagttgccggaaaataa

DBGET integrated database retrieval system