KEGG   Bacillus subtilis subsp. subtilis 168: BSU22800
Entry
BSU22800          CDS       T00010                                 

Symbol
spoIVA
Name
(RefSeq) stage IV sporulation protein A
  KO
K06398  stage IV sporulation protein A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU22800 (spoIVA)
SSDB
Motif
Pfam: SpoIVA_ATPase SpoIVA_middle SpoIVA_C MMR_HSR1 GTP_EFTU Dynamin_N MeaB
Other DBs
NCBI-GeneID: 938991
NCBI-ProteinID: NP_390161
Pasteur: BG10275
BSORF: BG10275
UniProt: P35149 A0A6M4JNA2
Position
complement(2386195..2387673)
AA seq 492 aa
MEKVDIFKDIAERTGGDIYLGVVGAVRTGKSTFIKKFMELVVLPNISNEADRARAQDELP
QSAAGKTIMTTEPKFVPNQAMSVHVSDGLDVNIRLVDCVGYTVPGAKGYEDENGPRMINT
PWYEEPIPFHEAAEIGTRKVIQEHSTIGVVITTDGTIGDIARSDYIEAEERVIEELKEVG
KPFIMVINSVRPYHPETEAMRQDLSEKYDIPVLAMSVESMRESDVLSVLREALYEFPVLE
VNVNLPSWVMVLKENHWLRESYQESVKETVKDIKRLRDVDRVVGQFSEFEFIESAGLAGI
ELGQGVAEIDLYAPDHLYDQILKEVVGVEIRGRDHLLELMQDFAHAKTEYDQVSDALKMV
KQTGYGIAAPALADMSLDEPEIIRQGSRFGVRLKAVAPSIHMIKVDVESEFAPIIGTEKQ
SEELVRYLMQDFEDDPLSIWNSDIFGRSLSSIVREGIQAKLSLMPENARYKLKETLERII
NEGSGGLIAIIL
NT seq 1479 nt   +upstreamnt  +downstreamnt
ttggaaaaggtcgatattttcaaggatatcgctgaacgaacaggaggcgatatatactta
ggagtcgtaggtgctgtccgtacaggaaaatccacgttcattaaaaaatttatggagctt
gtggtgctcccgaatatcagtaacgaagcagaccgggcccgagcgcaggatgaactgccg
cagagcgcagccggcaaaaccattatgactacagagcctaaatttgttccgaatcaggcg
atgtctgttcatgtgtcagacggactcgatgtgaatataagattagtagattgtgtaggt
tacacagtgcccggcgctaaaggatatgaagatgaaaacgggccgcggatgatcaatacg
ccttggtacgaagaaccgatcccatttcatgaggctgctgaaatcggcacacgaaaagtc
attcaagaacactcgaccatcggagttgtcattacgacagacggcaccattggagatatc
gccagaagtgactatatagaggctgaagaaagagtcattgaagagctgaaagaggttggc
aaaccttttattatggtcatcaactcagtcaggccgtatcacccggaaacggaagccatg
cgccaggatttaagcgaaaaatatgatatcccggtattggcaatgagtgtagagagcatg
cgggaatcagatgtgctgagtgtgctcagagaggccctctacgagtttccggtgctagaa
gtgaatgtcaatctcccaagctgggtaatggtgctgaaagaaaaccattggttgcgtgaa
agctatcaggagtccgtgaaggaaacggttaaggatattaaacggctccgggacgtagac
agggttgtcggccaattcagcgagtttgaattcattgaaagtgccggattagccggaatt
gagctgggccaaggggtggcagaaattgatttgtacgcgcctgatcatctatatgatcaa
atcctaaaagaagttgtgggcgtcgaaatcagaggaagagaccatctgcttgagctcatg
caagacttcgcccatgcgaaaacagaatatgatcaagtgtctgatgccttaaaaatggtc
aaacagacgggatacggcattgcagcgcctgctttagctgatatgagtctcgatgagccg
gaaattataaggcagggctcgcgattcggtgtgaggctgaaagctgtcgctccgtcgatc
catatgatcaaagtagatgtcgaaagcgaattcgccccgattatcggaacggaaaaacaa
agtgaagagcttgtacgctatttaatgcaggactttgaggatgatccgctctccatctgg
aattccgatatcttcggaaggtcgctgagctcaattgtgagagaagggattcaggcaaag
ctgtcattgatgcctgaaaacgcacggtataaattaaaagaaacattagaaagaatcata
aacgaaggctctggcggcttaatcgccatcatcctgtaa

DBGET integrated database retrieval system