KEGG   Bacillus subtilis subsp. subtilis 168: BSU22810
Entry
BSU22810          CDS       T00010                                 

Symbol
yphF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938992
NCBI-ProteinID: NP_390162
Pasteur: BG10274
BSORF: BG10274
UniProt: P39911 A0A6M4JIN8
Position
complement(2387854..2388588)
AA seq 244 aa
MGKLKCAIIFAAVVFLSGCLYPNERKSSVHAIPYQDQLKQVQSAVDEFQKANGGLLPIQT
KDMSTPLYQKYPIDFNRLAPRYIAEPPSTAFESGGDYQYVLVDVENDPTVKLIDLKMAEK
IRDVKLRIQMYRQEHQYPPYKDVLSRDLFTLDEKKLGDGSSLTVTSPISGNSLPLMIDGD
GEIYADYRTELASCLKKSKKTFKPGTEIQDMIWHETPFVPAFSVKYTVNDKQEPVFLEND
MKKE
NT seq 735 nt   +upstreamnt  +downstreamnt
atgggtaaactgaagtgcgcaatcatttttgcggcagtcgtgtttttatccggatgttta
tatccaaatgaacggaaaagcagtgtgcatgccattccttatcaagaccagctaaagcag
gttcaatctgctgttgatgaatttcaaaaggcaaatggagggctgcttcctattcaaacc
aaagatatgtcgacaccgctatatcaaaaatatccgatagactttaaccggttagcgcca
agatacatagctgaacctccaagtacggcatttgaaagcgggggagactatcaatacgtg
cttgttgacgtagagaacgatccgactgttaaattaattgatctaaagatggcagaaaaa
attcgcgatgtgaaattgcgcatccaaatgtatcgtcaggagcatcaatatccgccttac
aaggatgtgctatctcgtgatttatttacactcgatgagaagaagcttggggatggcagc
tctcttacagtgacaagcccaatctcagggaattccttgccgcttatgattgacggagac
ggagaaatatatgccgattaccggactgagctggcttcttgcctcaaaaaaagcaaaaaa
acgtttaaacccgggactgaaatccaggatatgatttggcatgaaaccccctttgtcccc
gcgttttctgtaaaatatacggtaaatgacaaacaggaacctgtttttttagaaaatgat
atgaaaaaggaatga

DBGET integrated database retrieval system