KEGG   Bacillus subtilis subsp. subtilis 168: BSU22820
Entry
BSU22820          CDS       T00010                                 

Symbol
yphE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2768 DUF2545 DUF6747 Herpes_UL73
Other DBs
NCBI-GeneID: 938993
NCBI-ProteinID: NP_390163
Pasteur: BG11444
BSORF: BG11444
UniProt: P50744 A0A6M3ZD56
Position
complement(2388610..2388813)
AA seq 67 aa
MNLALMKMWFALGSMGLMFLAVASIYLSRFKCQNRFLKIAISSFAYMCMLISGIIVFVVV
FSGPVNE
NT seq 204 nt   +upstreamnt  +downstreamnt
ttgaatctggcattgatgaaaatgtggtttgctctagggtccatgggtctgatgtttctg
gctgtagcttccatctatttaagccgctttaagtgccaaaaccgttttttgaagattgcg
atttcatcattcgcatacatgtgtatgctcatatctggaattattgtgtttgtcgtggtt
tttagcggccctgtcaatgaataa

DBGET integrated database retrieval system