KEGG   Bacillus subtilis subsp. subtilis 168: BSU22830
Entry
BSU22830          CDS       T00010                                 

Symbol
gpsA
Name
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU22830 (gpsA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     BSU22830 (gpsA)
SSDB
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N F420_oxidored ApbA NAD_binding_2 IlvN UDPG_MGDP_dh_N PDH 3HCDH_N 2-Hacid_dh_C AlaDh_PNT_C DpaA_N Shikimate_DH UDPG_MGDP_dh_C Glyco_hydro_4 2-Hacid_dh
Other DBs
NCBI-GeneID: 938989
NCBI-ProteinID: NP_390164
Pasteur: BG11366
BSORF: BG11366
UniProt: P46919 A0A6M4JKF2
Position
complement(2389151..2390188)
AA seq 345 aa
MKKVTMLGAGSWGTALALVLTDNGNEVCVWAHRADLIHQINELHENKDYLPNVKLSTSIK
GTTDMKEAVSDADVIIVAVPTKAIREVLRQAVPFITKKAVFVHVSKGIEPDSLLRISEIM
EIELPSDVRKDIVVLSGPSHAEEVGLRHPTTVTASSKSMRAAEEVQDLFINHNFRVYTNP
DIIGVEIGGALKNIIALAAGITDGLGYGDNAKAALITRGLAEIARLGTKMGGNPLTFSGL
TGVGDLIVTCTSVHSRNWRAGNLLGKGYKLEDVLEEMGMVVEGVRTTKAAYQLSKKYDVK
MPITEALHQVLFNGQKVETAVESLMARGKTHEMEDLVNTFENQVK
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaaaaaagtcacaatgcttggagcggggagttggggaacagcactggctttagttcta
actgataatggaaatgaagtgtgtgtgtgggctcaccgtgcagatttaattcatcaaatt
aatgagttgcatgaaaacaaagattatttgccgaatgttaagctgtctacatccattaaa
ggaacaacagatatgaaagaggctgtttcagacgcagatgtcattatcgttgcggtcccg
acaaaagcaattcgggaagtgctgagacaggctgtcccttttataacgaaaaaggcagtc
tttgttcatgtcagcaagggtattgagccagattcacttctgcgcatttctgaaattatg
gaaattgagctcccgagtgatgtcagaaaagatatcgttgtcctttccggcccgagtcat
gcggaagaagtagggctgcggcaccccacaactgttactgcatcttcaaagagcatgagg
gcagcagaagaggtgcaggatctatttattaatcacaattttcgggtgtacacaaatcct
gacattatcggagttgaaatcggaggggctttaaaaaatattattgcccttgctgcagga
attacagatggtttagggtacggtgacaatgccaaagctgctttgattacacgcggactt
gccgaaatcgcgagactcggaacgaaaatgggcggaaatcccttgacgttctctggattg
acaggagtaggcgatctgattgtgacgtgcacaagtgttcattccagaaactggcgtgcg
ggcaatttgctcggaaaagggtacaagcttgaagatgttcttgaagagatgggaatggta
gtcgaaggcgtccgcacgacgaaagcggcttatcagctttcgaagaaatatgatgttaaa
atgccgattacagaagctctccatcaggtcctattcaacggacaaaaagtggaaaccgct
gttgaatctttaatggcgagagggaaaacccacgagatggaggatttggtaaatacgttt
gaaaatcaagtgaagtaa

DBGET integrated database retrieval system