KEGG   Bacillus subtilis subsp. subtilis 168: BSU22849
Entry
BSU22849          CDS       T00010                                 

Symbol
ypzH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303000
NCBI-ProteinID: YP_003097755
UniProt: C0H445 A0A6M3ZDH3
Position
complement(2391670..2391864)
AA seq 64 aa
MSESLTKVILSVITTNRNRVAGGAPVFFCNDQKEMELFAKNLEAILDGIAHRIGDDVYLI
VKHF
NT seq 195 nt   +upstreamnt  +downstreamnt
atgagtgaatctcttacgaaagtgattttgtctgtaatcacgacaaatcgaaatcgggtt
gcagggggagcacctgtctttttttgcaatgaccaaaaggagatggagcttttcgctaaa
aatcttgaggcgatccttgatggaatagctcacagaatcggagatgacgtgtatttgatc
gtgaaacatttttaa

DBGET integrated database retrieval system