KEGG   Bacillus subtilis subsp. subtilis 168: BSU22850
Entry
BSU22850          CDS       T00010                                 

Symbol
seaA
Name
(RefSeq) hypothetical protein
  KO
K05739  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU22850 (seaA)
SSDB
Motif
Pfam: YIEGIA DUF3165
Other DBs
NCBI-GeneID: 938990
NCBI-ProteinID: NP_390166
Pasteur: BG11442
BSORF: BG11442
UniProt: P50742 A3F421
Position
complement(2391861..2392754)
AA seq 297 aa
MSDYIYPIIAGVIAGIATRLYMLKTDYRQYPTYVHGKVIHIALGLIAAGLGAIIMPALLQ
EEFTAITFLTLAATQFRDVRNMERNTLTQMDSYELVSRGSTYIEGIAIAFESRNYIVIFT
ALLTTSAYVFLSIWAAVIAAVVCFLLAMKFMSGSVLKDIVDIEYIKPRFDGPGLFVDNIY
MMNIGLPEKQELILKHGMGFILTPKNFNSAATIANLGQRQAILFDVSNVLGVYRDSGEPS
LTPIAKRDLNDGRVAVFVLPQIHHPETAVQIISNVPTLENAIRMPTEFIKNQDKVIG
NT seq 894 nt   +upstreamnt  +downstreamnt
atgagtgattacatctatccgattattgctggggtcattgccggaattgcgacaaggctt
tatatgctgaaaacggattaccgccagtatccgacctatgttcatgggaaagtgattcac
atcgcactggggttgatagcggctggtttaggtgcaattattatgccggcgcttttgcag
gaggaatttacggccatcacatttttaacattggcagcgacgcaatttagagatgtccga
aacatggagcggaacacattgacgcaaatggattcgtatgaacttgtctcaaggggaagc
acatatattgaggggattgccattgcgtttgaaagcagaaattatattgtgatctttaca
gcgcttttgacaacctctgcgtatgtgtttttatccatctgggctgcagtcatagcggct
gtcgtttgttttttactggccatgaagtttatgtcgggcagtgtgttgaaggatattgta
gatatcgagtacataaagccgcgctttgacggtccgggactgtttgttgataatatttat
atgatgaatatcgggcttccagagaaacaggaactgattttaaagcatggcatgggcttt
attttgacgccgaaaaactttaattcagcagcgacgatagcaaatttagggcagcgtcag
gccattttatttgatgtttccaatgtgctcggggtttatcgggattcaggagagccatct
ttgacaccaattgcaaaacgggatttaaatgatgggagagtggcagtatttgttctcccg
caaattcaccatcccgaaacggctgttcaaattattagcaatgttccaaccctggaaaat
gcgattagaatgccgactgaatttatcaagaatcaggataaggtgataggatga

DBGET integrated database retrieval system