KEGG   Bacillus subtilis subsp. subtilis 168: BSU22890
Entry
BSU22890          CDS       T00010                                 

Gene name
cmk
Definition
(RefSeq) cytidylate kinase
  KO
K00945  CMP/dCMP kinase [EC:2.7.4.25]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU22890 (cmk)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.25  (d)CMP kinase
     BSU22890 (cmk)
SSDB
Motif
Pfam: Cytidylate_kin Cytidylate_kin2 AAA_18 SKI AAA_33 AAA_17 DUF4424 AAA_22 ADK ABC_tran dNK ATP_bind_2
Other DBs
NCBI-GeneID: 938982
NCBI-ProteinID: NP_390170
Pasteur: BG11004
BSORF: BG11004
UniProt: P38493 A3F447
Position
complement(2396045..2396719)
AA seq 224 aa
MEKKLSIAIDGPAAAGKSTVAKIVAEKKSYIYIDTGAMYRAITYAALQENVDLTDEEKLA
ELLKRTDIELITTKDGQKVFVNGTDVTEAIRTDEISNQVSIAAKHRSVREEMVKRQQQLG
EKGGVVMDGRDIGTHVLPNAEVKIFLLASVEERAKRRYEENVKKGFDVNYETLIEEIARR
DKLDSEREVSPLRKAEDALEIDTTSLSIQEVADKILEAVEQKSR
NT seq 675 nt   +upstreamnt  +downstreamnt
atggaaaagaaattatcgattgcaatcgacggcccggcagctgcggggaaaagcaccgtt
gccaaaattgtggctgagaaaaaatcgtacatatatattgatacaggagcgatgtatcgg
gcgattacgtacgcggctttacaggaaaacgttgatctgacagatgaagaaaaactggct
gagctgctaaagcggacagacattgagctgattacaacaaaagatggacaaaaagtgttt
gtaaacggcaccgatgtaactgaggcgatcagaacagatgaaatcagcaaccaagtttca
attgcggccaagcacagaagtgtcagagaagaaatggtgaaacgccagcagcagcttggg
gaaaaaggcggcgtcgtcatggatggtcgtgacatcgggacgcatgtgctgccaaatgca
gaagtaaaaatctttcttttggcatctgtggaagagagagcgaaacgccgttatgaagaa
aatgtgaaaaaaggctttgatgtcaactacgaaacattaattgaggaaattgcaagaaga
gacaagcttgattcagagcgcgaagtatctccgctgcgtaaagcagaagacgctcttgaa
atcgacacgacatcgctttccattcaagaggtagctgataaaatcctcgaggctgtggag
caaaagtcccgctga

DBGET integrated database retrieval system