KEGG   Bacillus subtilis subsp. subtilis 168: BSU22900
Entry
BSU22900          CDS       T00010                                 

Symbol
ypfB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5359 Glyco_transf_92
Other DBs
NCBI-GeneID: 938983
NCBI-ProteinID: NP_390171
Pasteur: BG11003
BSORF: BG11003
UniProt: P38492 A0A6M4JIL5
Position
complement(2396798..2396974)
AA seq 58 aa
MKTFERLLIKLLFIQAIILLGVQFLFHYQHIEPYVSKVIQYEGVDKMEENNRIETFKH
NT seq 177 nt   +upstreamnt  +downstreamnt
atgaaaacatttgaacggctgctgatcaaattattgttcattcaggccatcattttactt
ggtgtccaatttctttttcactatcagcatattgaaccatacgtatcaaaagtgattcaa
tatgaaggggtggataaaatggaggaaaacaataggattgaaaccttcaaacattaa

DBGET integrated database retrieval system