KEGG   Bacillus subtilis subsp. subtilis 168: BSU22910
Entry
BSU22910          CDS       T00010                                 

Symbol
dgrA
Name
(RefSeq) c-di-GMP receptor protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PilZNR PilZ Topoisom_I
Other DBs
NCBI-GeneID: 938984
NCBI-ProteinID: NP_390172
Pasteur: BG11002
BSORF: BG11002
UniProt: P38491 A0A6M3ZDD6
Structure
Position
complement(2397019..2397672)
AA seq 217 aa
MIEIGENVLLEYIEENELKKAKSKAVSIENNELLIAYPVDVVTGRTVILHNDMEVTVEFV
GKDEVPYRFISRIKGKVKDKLQMICLEMPPREKMKRIQRRQYVRTDAVLDVQIQPGNEEE
IRTLSYNISAGGIAVVLADGLSFQSGESLRLIIRLPEEEHTRQIETEAVVRRIFNDPKSE
KRKMTLEYSEIAAGDQQALLQYCIRRQLNKRRKARME
NT seq 654 nt   +upstreamnt  +downstreamnt
atgatagagattggagaaaatgtacttttagaatatatagaagaaaatgaattgaaaaag
gcaaaaagcaaggcggtcagcatcgaaaacaatgaacttttgatcgcgtatcctgttgat
gtagttacagggcgaactgtgattttacataacgatatggaagtaacggtagagtttgtg
ggaaaagacgaagttccttatcgctttataagccgtataaaaggtaaagtgaaggacaaa
cttcaaatgatctgtcttgaaatgcctccccgtgaaaaaatgaaaagaatccagcgccgc
caatatgtaagaactgatgcggtattagatgtgcaaattcagccgggaaatgaagaagag
atccgcacactatcctataacatcagtgcaggcggcatcgccgtggttttagctgatggc
ctttcttttcaatcgggggaatcattgcgcctgatcatccgtcttcctgaagaggagcac
acacgtcaaatagaaacagaagcagttgtcagacgaatctttaatgaccccaagtcagaa
aaacgaaaaatgactttagagtattcagaaattgcagcaggtgaccagcaggctttgctt
caatactgcatcaggcgccagttaaataagagaagaaaggcccgaatggaataa

DBGET integrated database retrieval system