KEGG   Bacillus subtilis subsp. subtilis 168: BSU22920
Entry
BSU22920          CDS       T00010                                 

Symbol
ypeB
Name
(RefSeq) sporulation protein YpeB
  KO
K06313  spore germination protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU22920 (ypeB)
SSDB
Motif
Pfam: YPEB PepSY Prominin DUF2371
Other DBs
NCBI-GeneID: 938981
NCBI-ProteinID: NP_390173
Pasteur: BG11001
BSORF: BG11001
UniProt: P38490 A0A6M3ZGS5
Position
complement(2397765..2399117)
AA seq 450 aa
MIRGILIAVLGIAIVGTGYWGYKEHQEKDAVLLHAENNYQRAFHELTYQVDQLHDKIGTT
LAMNSQKSLSPALIDVWRITSEAHNSVSQLPLTLMPFNKTEELLSKIGDFSYKTSVRDLD
QKPLDKNEYTSLNKLYQQSEDIQNELRHVQHLVMSKNLRWMDVEMALASDEKQSDNTIIN
SFKTVEKNVGAFSTGTDLGPSFTSTKKEEKGFSHLKGKQISEQEAKQIAERFAPDDNYSI
KVVKSGKKTNRDVYSISMKDPDHKAVIYMDITKKGGHPVYLIQNREVKDQKISLNDGSNR
ALAFLKKNGFETDDLEIDESAQYDKIGVFSYVPVENKVRMYPEAIRMKVALDDGEVVGFS
ARDFLTSHRKRTIPKPAITEAEAKSKLNKNVQVRETRLALITNELGQEVLCYEMLGTIEN
DTFRMYINAKDGSEEKVEKLKNAEPIYKDL
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgatcagaggaattttaatcgccgtgcttggtattgcaatagtcggtacaggctactgg
ggatacaaagaacaccaggaaaaagacgcagttcttcttcatgctgaaaataactatcag
cgggcgtttcatgagcttacctatcaggtggatcagcttcatgataaaatcggaacaaca
cttgccatgaacagccaaaaatcactgtcgcctgcattgatcgatgtgtggaggattaca
tcagaagctcataacagcgtcagtcagctgccgcttacattaatgccgtttaataaaact
gaagagctattatcaaagatcggcgatttcagctataaaacgtcagtcagagatttggac
caaaagccgcttgataaaaacgagtatacatcactaaataagctatatcagcagtccgaa
gatatacaaaatgaattgcgtcatgttcagcaccttgtcatgagcaaaaaccttcgctgg
atggacgtagaaatggctctggcttctgacgaaaaacaaagtgataatacgattatcaac
agctttaaaacagtcgaaaaaaatgttggtgcattctccactggcactgatcttggcccg
agtttcaccagtacgaaaaaagaagagaaaggcttcagccatctgaagggaaaacaaatt
tccgaacaggaagcaaaacaaattgctgagcgctttgccccagatgacaattattcaatt
aaagtggtaaagagcggaaaaaaaacaaatcgcgatgtatatagcatcagcatgaaagac
ccagaccataaagcagtgatttatatggatattacgaagaagggcgggcatccggtatac
ttgatccaaaacagagaagtgaaagatcagaaaatcagtttaaatgacggatcgaaccga
gcgcttgcatttttaaagaaaaacggatttgaaacagatgatttggaaattgatgaaagt
gcccaatatgataaaatcggtgtattttcatatgttcctgttgaaaataaagtccggatg
taccccgaggcaattcgtatgaaagtggccttggatgacggtgaggttgtcggcttttca
gcaagagacttcctcacatctcacagaaaaagaaccatacctaagcctgcaattactgaa
gcagaggcaaagtctaaattaaataaaaatgtacaagtgagagaaacaaggctcgctttg
attacaaatgaactaggtcaagaagtgttatgctacgaaatgcttgggacaattgaaaat
gacacattcagaatgtatatcaatgccaaagacggatcggaagaaaaggttgaaaaacta
aaaaatgcagaacctatatataaagacctataa

DBGET integrated database retrieval system