KEGG   Bacillus subtilis subsp. subtilis 168: BSU22950Help
Entry
BSU22950          CDS       T00010                                 

Gene name
ypdA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_3 Pyr_redox_2 HI0933_like Pyr_redox GIDA FAD_binding_2 FAD_binding_3 NAD_binding_8 Thi4 NAD_binding_7 DAO FAD_oxidored K_oxygenase Lycopene_cycl FMO-like
Motif
Other DBs
NCBI-GeneID: 938977
NCBI-ProteinID: NP_390176
Pasteur: BG11436
BSORF: BG11436
UniProt: P50736
Position
complement(2400984..2401958)
Genome map
AA seq 324 aa AA seqDB search
MIQEKAIIIGGGPCGLSAAIHLKQIGIDALVIEKGNVVNSIYNYPTHQTFFSSSEKLEIG
DVAFITENRKPVRIQALSYYREVVKRKNIRVNAFEMVRKVTKTQNNTFVIETSKETYTTP
YCIIATGYYDHPNYMGVPGEDLPKVFHYFKEGHPYFDKDVVVIGGKNSSVDAALELVKSG
ARVTVLYRGNEYSPSIKPWILPEFEALVRNGTIRMEFGACVEKITENEVVFRSGEKELIT
IKNDFVFAMTGYHPDHQFLEKIGVEIDKETGRPFFNEETMETNVEGVFIAGVIAAGNNAN
EIFIENGRFHGGHIAAEIAKRENH
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagaaaaagcaattattataggcggaggaccttgtggactatctgctgccatt
cacctaaaacaaattggcattgatgccctcgtcatcgaaaaaggcaatgtcgttaacagt
atttacaattacccgacgcatcaaacctttttcagttcaagtgaaaagctcgaaatcgga
gatgtggcatttattacagagaacaggaagcctgtcagaattcaggctttatcgtattac
cgggaagtcgttaaacggaaaaacatccgtgttaatgcgtttgaaatggtgcgtaaagtg
acgaaaacgcaaaataacacattcgttattgagacgtcaaaagagacctacacgacgcca
tattgtatcatcgccacaggctattatgatcatccaaactatatgggcgtacccggtgag
gatttgccgaaagtatttcattattttaaagaaggccacccgtattttgataaagatgtt
gttgtcatcggcgggaaaaattcaagcgtggacgccgcccttgaactcgtgaaatctggg
gcgcgtgtcacagttttatataggggcaatgagtattctccgagcattaagccgtggatt
ctgccggaatttgaagctctcgtcagaaacggtacaatccgtatggaatttggagcttgt
gtcgaaaaaatcaccgagaatgaagttgtgtttcgctccggagagaaagaactcattacc
attaaaaatgattttgtatttgccatgacaggctatcatcccgatcatcaatttcttgaa
aaaattggtgttgaaattgataaagaaacagggcgtccatttttcaacgaagaaacgatg
gaaacgaacgttgaaggtgtctttattgccggtgttattgctgcgggaaacaatgcaaat
gaaatatttattgaaaacggcaggtttcacggggggcatatcgcagcggaaatcgccaaa
agagaaaaccattaa

DBGET integrated database retrieval system