KEGG   Bacillus subtilis subsp. subtilis 168: BSU22950
Entry
BSU22950          CDS       T00010                                 

Symbol
ypdA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Pyr_redox_3 Pyr_redox_2 Pyr_redox HI0933_like GIDA FAD_binding_2 FAD_binding_3 NAD_binding_8 DAO Thi4 NAD_binding_7 Lycopene_cycl FMO-like FAD_oxidored
Other DBs
NCBI-GeneID: 938977
NCBI-ProteinID: NP_390176
Pasteur: BG11436
BSORF: BG11436
UniProt: P50736 A0A6M3ZIP2
Position
complement(2400984..2401958)
AA seq 324 aa
MIQEKAIIIGGGPCGLSAAIHLKQIGIDALVIEKGNVVNSIYNYPTHQTFFSSSEKLEIG
DVAFITENRKPVRIQALSYYREVVKRKNIRVNAFEMVRKVTKTQNNTFVIETSKETYTTP
YCIIATGYYDHPNYMGVPGEDLPKVFHYFKEGHPYFDKDVVVIGGKNSSVDAALELVKSG
ARVTVLYRGNEYSPSIKPWILPEFEALVRNGTIRMEFGACVEKITENEVVFRSGEKELIT
IKNDFVFAMTGYHPDHQFLEKIGVEIDKETGRPFFNEETMETNVEGVFIAGVIAAGNNAN
EIFIENGRFHGGHIAAEIAKRENH
NT seq 975 nt   +upstreamnt  +downstreamnt
atgattcaagaaaaagcaattattataggcggaggaccttgtggactatctgctgccatt
cacctaaaacaaattggcattgatgccctcgtcatcgaaaaaggcaatgtcgttaacagt
atttacaattacccgacgcatcaaacctttttcagttcaagtgaaaagctcgaaatcgga
gatgtggcatttattacagagaacaggaagcctgtcagaattcaggctttatcgtattac
cgggaagtcgttaaacggaaaaacatccgtgttaatgcgtttgaaatggtgcgtaaagtg
acgaaaacgcaaaataacacattcgttattgagacgtcaaaagagacctacacgacgcca
tattgtatcatcgccacaggctattatgatcatccaaactatatgggcgtacccggtgag
gatttgccgaaagtatttcattattttaaagaaggccacccgtattttgataaagatgtt
gttgtcatcggcgggaaaaattcaagcgtggacgccgcccttgaactcgtgaaatctggg
gcgcgtgtcacagttttatataggggcaatgagtattctccgagcattaagccgtggatt
ctgccggaatttgaagctctcgtcagaaacggtacaatccgtatggaatttggagcttgt
gtcgaaaaaatcaccgagaatgaagttgtgtttcgctccggagagaaagaactcattacc
attaaaaatgattttgtatttgccatgacaggctatcatcccgatcatcaatttcttgaa
aaaattggtgttgaaattgataaagaaacagggcgtccatttttcaacgaagaaacgatg
gaaacgaacgttgaaggtgtctttattgccggtgttattgctgcgggaaacaatgcaaat
gaaatatttattgaaaacggcaggtttcacggggggcatatcgcagcggaaatcgccaaa
agagaaaaccattaa

DBGET integrated database retrieval system