KEGG   Bacillus subtilis subsp. subtilis 168: BSU22960
Entry
BSU22960          CDS       T00010                                 

Symbol
gudB
Name
(RefSeq) cryptic catabolic NAD-specific glutamate dehydrogenase GudB
  KO
K00260  glutamate dehydrogenase [EC:1.4.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00430  Taurine and hypotaurine metabolism
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU22960 (gudB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU22960 (gudB)
   00220 Arginine biosynthesis
    BSU22960 (gudB)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BSU22960 (gudB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     BSU22960 (gudB)
SSDB
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C NAD_binding_7
Other DBs
NCBI-GeneID: 938975
NCBI-ProteinID: NP_390177
Pasteur: BG11435
BSORF: BG11435
UniProt: P50735 A0A6M3ZDW6
Structure
PDB: 
3K8Z

Position
complement(2402067..2403350)
AA seq 427 aa
MAADRNTGHTEEDKLDVLKSTQTVIHKALEKLGYPEEVYELLKEPMRLLTVKIPVRMDDG
SVKIFTGYRAQHNDSVGPTKGGIRFHPNVTEKEVKAVKALSIWMSLKCGIIDLPYGGGKG
GIVCDPRDMSFRELERLSRGYVRAISQIVGPTKDVPAPDVFTNSQIMAWMMDEYSRIDEF
NSPGFITGKPLVLGGSHGRESATAKGVTICIKEAAKKRGIDIKGARVVVQGFGNAGSYLA
KFMHDAGAKVVGISDAYGGLYDPEGLDIDYLLDRRDSFGTVTKLFNDTITNQELLELDCD
ILVPAAIENQITEENAHNIRAKIVVEAANGPTTLEGTKILSDRDILLVPDVLASAGGVTV
SYFEWVQNNQGFYWSEEEVEEKLEKMMVKSFNNIYEMANNRRIDMRLAAYMVGVRKMAEA
SRFRGWI
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggcagccgatcgaaacaccggtcatacagaagaggacaaacttgatgtattaaaatca
acccaaaccgtaatacataaggctctggaaaaattgggatatcccgaagaggtatacgaa
ttgttaaaagagccgatgagattattaacggtaaaaatacctgttcgtatggacgacggt
tcagtaaagattttcacaggatatcgtgcgcagcacaatgactctgtcggtccaacgaaa
ggcgggatacgttttcacccgaacgtaacagaaaaagaggtgaaggcggtgaaggcgctt
tcaatttggatgagtttaaaatgcggcataattgatcttccatatggcggtggtaaaggc
ggaattgtttgtgatccaagggatatgtcgtttagagagctggagcgtctgagcagaggg
tatgtcagagcgatcagccaaattgtcggcccgacaaaagacgtgccggcaccggatgta
tttacaaactcacaaatcatggcttggatgatggatgagtattcaagaattgatgaattt
aattcgcctggatttattacaggcaaaccgcttgtgcttggcggatctcacgggagagaa
tctgcgacagcaaaaggtgttaccatctgtattaaagaagcggctaagaagagaggcatc
gatattaaaggtgcgcgtgtcgttgtccaaggcttcggaaacgcgggaagctatttggca
aaatttatgcatgatgcgggggcaaaagttgtcggcatctcagatgcgtatggcggactt
tatgatccggaaggccttgatatcgattatttactcgaccgacgcgacagcttcggtacc
gtaacaaagcttttcaacgataccattaccaaccaagagctgctggagctggattgtgat
attctcgttcctgctgcgattgaaaatcaaattacagaagaaaatgcccataatatccgg
gctaaaattgtcgttgaagcagcgaacggaccaacaacgcttgaaggaacaaaaattctt
tcagaccgggacattctgcttgtaccagacgtgctggcaagtgccggtggcgtaacagtt
tcttattttgaatgggttcagaataaccaaggcttctactggagtgaagaagaggtagaa
gaaaaattagaaaaaatgatggtcaaatcatttaacaatatttacgaaatggctaacaac
cgaagaattgacatgaggctcgctgcatatatggtcggcgttcgcaaaatggctgaagct
tcgcgttttagaggctggatataa

DBGET integrated database retrieval system