KEGG   Bacillus subtilis subsp. subtilis 168: BSU22970
Entry
BSU22970          CDS       T00010                                 

Gene name
ypbH
Definition
(RefSeq) adapter protein MecA
  KO
K16511  adapter protein MecA 1/2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BSU22970 (ypbH)
SSDB
Motif
Pfam: MecA AstA
Other DBs
NCBI-GeneID: 938980
NCBI-ProteinID: NP_390178
Pasteur: BG11434
BSORF: BG11434
UniProt: P50734
Structure
PDB: 
3JTN 3JTO

Position
complement(2403506..2404090)
AA seq 194 aa
MRLERLNYNKIKIFLTLDDLTDRGLTKEDLWKDSFKVHQLFKDMMNEANTELGFEANGPI
AVEVYSLQAQGMVVIVTKNQDADSEDDEYDDDYIEMQVKLDESADIIYQFHSFEDIIQLS
ESLQRIGITGGTVYHYDGQYFLSLEDLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLI
MDGNAVETIQTHFS
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcggcttgagcgtctgaattataataagatcaaaatctttttaaccctcgatgatttg
acagaccggggattgacaaaagaagacctctggaaggactcatttaaagtccaccagtta
tttaaagatatgatgaatgaagcaaatacagagctcggctttgaagcgaatggaccgatt
gcagtggaagtgtattctctccaagcacaagggatggtcgtgattgtaacaaagaaccaa
gacgccgattcagaagacgatgagtatgatgatgattacatcgaaatgcaagtcaagctt
gatgaaagcgcggacatcatatatcaattccattcctttgaagatatcattcagctttca
gaaagcttacagcgaatcggtatcacagggggaactgtctaccactatgacgggcagtac
tttttaagccttgaagatctagggtcacatacggctgaaggggttgtggcggttctggct
gaatacggcaatccgacaactttaacgatttatcgcctgcaagagtatggtaagctcatt
atggacggtaatgccgtagaaacgatacaaactcatttttcataa

DBGET integrated database retrieval system