KEGG   Bacillus subtilis subsp. subtilis 168: BSU22980
Entry
BSU22980          CDS       T00010                                 

Symbol
ypbG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Metallophos Metallophos_2 Apex
Other DBs
NCBI-GeneID: 938974
NCBI-ProteinID: NP_390179
Pasteur: BG11433
BSORF: BG11433
UniProt: P50733 A0A6M3ZDK5
Position
complement(2404249..2405028)
AA seq 259 aa
MKLSVKIAGVLTVAAAAMTAKMYATAKGNHLKTHTFPLSKMKGKPPLTIFFISDIHKRLI
DQDLLEKARSHAPHLVIIGGDLAEGGVPSARIEENIKRLVHFGVPIVFVWGNNDYEVRQH
KLYSIFKAHGVITLRNESVPFSYNGHTIAIAGVDDIRMEMDHYEEAIKELDESQLNILVC
HNPEIHEQINEDDGIDVILSGHTHGGQIRFGKFGPYELGKTGIVKNAAYLISNGYGTTKV
PLRLGAEPETHIVTLCGPE
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaagctatcagtgaaaattgccggtgtactaactgttgcggcagcggcaatgacggca
aaaatgtatgcaacagcaaaaggcaatcatttgaagacacatacgtttcctttatcaaag
atgaagggcaagccgcctctgacaatcttttttatttcagacattcacaaacgtctcatc
gatcaagaccttttagaaaaagcgcgaagccatgccccccacttggttataatcggcggt
gatttagctgagggcggggtgcccagtgcgagaatcgaggaaaacatcaaaaggctcgta
catttcggggtccctatcgtgtttgtgtgggggaataatgattatgaagtcaggcagcat
aagctgtattccatatttaaagcgcacggcgtcatcactctgagaaatgagtcagtcccg
ttttcatacaatgggcatacgattgcgattgcgggggttgatgatatcaggatggagatg
gatcattatgaggaagccatcaaagaacttgatgaaagccagctgaatattctggtttgc
cataatccggagattcatgaacaaatcaatgaagatgacggtattgatgtgatactcagc
ggacatacccatggaggccagatcaggtttggaaaattcggtccttatgaactggggaaa
acaggtattgttaaaaacgcggcatatctgatcagcaacggctacggcacgacaaaagtg
cctcttcgtttaggtgctgagcctgaaactcacattgtgactctttgcgggccagaataa

DBGET integrated database retrieval system