KEGG   Bacillus subtilis subsp. subtilis 168: BSU22990Help
Entry
BSU22990          CDS       T00010                                 

Gene name
ypbF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2663 SNARE
Motif
Other DBs
NCBI-GeneID: 938976
NCBI-ProteinID: NP_390180
Pasteur: BG11432
BSORF: BG11432
UniProt: P50732
Position
complement(2405114..2405557)
Genome map
AA seq 147 aa AA seqDB search
MESLWNQLDQFTDAPTKQMLQALVKRKQKFENYAAQCRRWRWASLICLGLLCVMIMIKSP
EPQLILQEILSHTFYLFWMLATAFAYCTSYYFKKKEEKSETDFHKLRCEIIQKSTDLWPQ
PDKWKARESVFHMMKHKYDINLYFESK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggaatccttatggaatcagctggatcagtttacagacgcgccgaccaaacagatgctc
caagcgctggtaaaacgaaaacaaaaattcgaaaattatgcagcacaatgccgcagatgg
cgatgggcttcacttatctgcctaggcttattatgtgttatgatcatgatcaaaagcccg
gagcctcagcttatacttcaagaaatacttagccataccttttatttattttggatgctg
gcaaccgcttttgcctactgcacttcatattatttcaagaaaaaggaagaaaaatccgag
actgatttccataaactgagatgtgaaattattcagaaaagcactgatctctggccgcag
cccgataaatggaaggcgagagagtctgtttttcatatgatgaagcacaaatatgacatt
aatctatattttgaaagtaaataa

DBGET integrated database retrieval system