KEGG   Bacillus subtilis subsp. subtilis 168: BSU23010
Entry
BSU23010          CDS       T00010                                 

Symbol
ypbD
Name
(RefSeq) hypothetical protein
  KO
K07052  CAAX protease family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU23010 (ypbD)
Peptidases and inhibitors [BR:bsu01002]
 Glutamic peptidases
  Family G5: prenyl protease 2 family
   BSU23010 (ypbD)
SSDB
Motif
Pfam: Rce1-like DUF1453
Other DBs
NCBI-GeneID: 938972
NCBI-ProteinID: NP_390182
Pasteur: BG11430
BSORF: BG11430
UniProt: P50730
Position
complement(2406293..2406862)
AA seq 189 aa
MTQLLIIFAAAAAGLFFFEDVRDVLKLWDIRDMRIIWYGVSIAVIVILADMAVMKWFPSH
LYDDGGINKKIFSKRSIPHIIFLTLLIAFAEEMLFRGVLQTHIGLWTASLIFAALHFRYL
SKWLLFIMVTAISFLLGLMYEWTGNLFVPMTAHFIIDAVFACQIRFEHVRRDKHDEHVES
REKKSPESL
NT seq 570 nt   +upstreamnt  +downstreamnt
ttgacgcagctactcatcatctttgccgctgctgcagcaggactgttcttttttgaggat
gtacgggacgtattaaagctctgggacattcgcgatatgcgaatcatctggtatggtgtt
tctatagctgttattgttattttagccgatatggcagtaatgaaatggtttccgtctcat
ttatatgatgacggcggaatcaataaaaaaatattcagtaagaggtcaatccctcatatt
atatttttaacgcttctgattgctttcgcggaagaaatgttattcagaggagtgctgcag
actcatatcggtttatggacggccagccttatatttgccgctctgcactttcggtatttg
tcaaaatggctgttatttattatggtgacagcaatcagctttttgctcggtctgatgtat
gaatggaccggcaacttatttgttccgatgacggcgcattttatcattgatgccgtgttt
gcctgtcagattcgttttgaacatgtgaggagggataaacatgacgaacatgtcgagagt
agagagaagaaaagcccagaatctttatga

DBGET integrated database retrieval system