KEGG   Bacillus subtilis subsp. subtilis 168: BSU23030
Entry
BSU23030          CDS       T00010                                 

Gene name
ypbB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_40 RQC Cu-oxidase_2
Other DBs
NCBI-GeneID: 938973
NCBI-ProteinID: NP_390184
Pasteur: BG11429
BSORF: BG11429
UniProt: P50728 A0A6M3ZIR5
Position
complement(2408405..2409463)
AA seq 352 aa
MSLNYFDIMVLDCLCKINGERSGSAVFHLFKGKRSSQTIQDAGLFQTAKYFGMAAKCSRS
DISASLDKLEKHSYLAPMSESDTYKVTASGAAVLRHALSERPWPVHCHGAHYQQAAGVLW
KRLSLLVQVLSHKQQGSRQYIPVTKDHKTLHWVKKYLSRHTDHIEMAKSLFAMLEAHLKK
IENKAAQIFVYSLTSHHRIGYTSRQLADTLKEDEWYVYIMFWASVHYFIHSLPECEDALL
KDLLSDVHLDNALTESTRKTWQMVKQGFPIQRIAEIRKLKTATIEDHIVEISLHEPAFMI
NDYVSAEDQLQIAEFAKRMRTNKIKQIRDGLEQRFSYFQIRLALTKQVQQYD
NT seq 1059 nt   +upstreamnt  +downstreamnt
ttgtcattaaattacttcgatattatggttctcgattgtctttgcaaaataaacggggaa
cggtcgggaagcgctgtttttcacctattcaaaggcaagagatcgtcacagaccattcaa
gatgccggcttatttcagactgcaaaatactttggaatggcggcaaaatgttcgagaagc
gatatttctgcgtcgcttgacaagcttgaaaagcattcatatctcgcgccaatgtctgaa
tcagatacatacaaagtgacagccagcggcgcagcagttttgagacatgcccttagcgag
cggccttggcccgttcattgtcacggcgctcattatcagcaggctgccggcgtgctttgg
aaaaggctttcgctgcttgtgcaggtcctatcccataaacagcaagggagcaggcagtat
atccctgtcacaaaggatcataagacacttcactgggtaaagaaatacctgtcccggcat
acggatcatatagagatggcaaaaagcctttttgccatgcttgaggcgcatttgaaaaag
attgaaaacaaagcagcgcaaatttttgtctactccttaacctcgcaccatcggatcggt
tatacgagcaggcagcttgctgatacgctgaaagaagacgaatggtatgtctatatcatg
ttttgggcttcggtacattattttattcattctcttccggagtgtgaagatgctttgtta
aaggatctcctttctgatgtgcacttagataatgccctgacagagtcgacgaggaaaaca
tggcagatggtcaaacaagggtttccgatacagcgaattgctgaaatcagaaagctgaaa
acagcgacgattgaagaccacattgtcgagatttctctccatgagcctgcgtttatgatt
aatgactatgtatcagcagaagaccagcttcaaatcgcagagtttgccaaacggatgcgg
acgaataaaatcaaacaaattcgcgacgggctggaacagcggttcagctactttcaaatc
agactggcattgacaaagcaggtgcagcaatatgactaa

DBGET integrated database retrieval system