KEGG   Bacillus subtilis subsp. subtilis 168: BSU23050
Entry
BSU23050          CDS       T00010                                 

Symbol
fmnP
Name
(RefSeq) riboflavin transporter FmnP
  KO
K23675  riboflavin transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU23050 (fmnP)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU23050 (fmnP)
SSDB
Motif
Pfam: ECF_trnsprt ECF-ribofla_trS 5TM-5TMR_LYT Thia_YuaJ
Other DBs
NCBI-GeneID: 938970
NCBI-ProteinID: NP_390186
Pasteur: BG11428
BSORF: BG11428
UniProt: P50726 A0A6M3ZDI8
Position
complement(2410017..2410589)
AA seq 190 aa
MKVKKLVVVSMLSSIAFVLMLLNFPFPGLPDYLKIDFSDVPAIIAILIYGPLAGIAVEAI
KNVLQYIIQGSMAGVPVGQVANFIAGTLFILPTAFLFKKLNSAKGLAVSLLLGTAAMTIL
MSILNYVLILPAYTWFLHSPALSDSALKTAVVAGILPFNMIKGIVITVVFSLIFIKLKPW
IEQQRSAHIH
NT seq 573 nt   +upstreamnt  +downstreamnt
gtgaaagtaaaaaaattagttgtggtcagcatgctgagcagcattgcatttgttttgatg
ctgttaaatttcccgtttccgggtcttccggattatttaaaaatcgattttagcgacgtt
cccgcaattattgccattctgatttacggacctttggcgggtattgccgtagaagcgata
aaaaatgttcttcagtatatcattcagggaagcatggccggagttcctgtagggcaagtt
gcgaattttattgcaggaacactctttatattaccgactgctttcttatttaaaaaactc
aactcagcaaagggcttggctgtcagcctgcttttgggaactgcagcgatgaccatttta
atgagtattttaaattatgttctgattcttccggcatacacgtggtttttacattcaccg
gcattatccgacagcgcgctaaaaacagcagtcgtcgcaggtatcctgccgtttaacatg
ataaaaggtattgtaattacggttgtattctcactaatttttatcaagcttaagccatgg
attgagcagcagcgaagtgcacatatccattaa

DBGET integrated database retrieval system