KEGG   Bacillus subtilis subsp. subtilis 168: BSU23060
Entry
BSU23060          CDS       T00010                                 

Symbol
ypzE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938967
NCBI-ProteinID: NP_390187
Pasteur: BG13767
BSORF: BG13767
Position
complement(2410695..2410859)
AA seq 54 aa
MKFPTGGDEPMALSPRAVFTAGFGEIPEPTVQSGWEKMEVHKRFEIEFFKRFFA
NT seq 165 nt   +upstreamnt  +downstreamnt
gtgaaattccctaccggcggtgatgagccaatggctctaagcccgcgagctgtctttaca
gcaggattcggtgagattccggagccgacagtacagtctggatgggagaagatggaggtt
cataagcgttttgaaattgaatttttcaaacgtttctttgcctag

DBGET integrated database retrieval system