KEGG   Bacillus subtilis subsp. subtilis 168: BSU23080
Entry
BSU23080          CDS       T00010                                 

Gene name
aroD
Definition
(RefSeq) 3-dehydroquinase
  KO
K03785  3-dehydroquinate dehydratase I [EC:4.2.1.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU23080 (aroD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     BSU23080 (aroD)
SSDB
Motif
Pfam: DHquinase_I DUF2576 IFN-gamma
Other DBs
NCBI-GeneID: 938963
NCBI-ProteinID: NP_390189
Pasteur: BG10538
BSORF: BG10538
UniProt: P35146 A0A6M4JM39
Position
complement(2412706..2413473)
AA seq 255 aa
MNVLTIKGVSIGEGMPKIIIPLMGKTEKQILNEAEAVKLLNPDIVEWRVDVFEKANDREA
VTKLISKLRKSLEDKLFLFTFRTHKEGGSMEMDESSYLALLESAIQTKDIDLIDIELFSG
DANVKALVSLAEENNVYVVMSNHDFEKTPVKDEIISRLRKMQDLGAHIPKMAVMPNDTGD
LLTLLDATYTMKTIYADRPIITMSMAATGLISRLSGEVFGSACTFGAGEEASAPGQIPVS
ELRSVLDILHKNTRG
NT seq 768 nt   +upstreamnt  +downstreamnt
gtgaacgtgttaacgattaaaggagtttccatcggggaagggatgccgaaaatcatcatt
ccgctgatgggaaagacggaaaaacaaattctgaatgaagcagaggcagtaaaattactg
aatccggacattgttgaatggagagtcgacgtatttgaaaaagcgaatgacagagaagcg
gtcacaaagctcatttctaagcttcgtaaatctttagaagacaagctatttctatttaca
ttcagaacccacaaagagggcgggagcatggagatggacgaaagctcctatcttgctttg
ctggaatcggcaatccaaacaaaagacatcgatctgatagacatcgaattattttcagga
gatgcaaatgtaaaagcgttagtatcgctggcggaagaaaacaacgtctatgtggtgatg
tcaaatcacgactttgaaaaaacacctgtaaaagatgaaattatttccagacttcgaaaa
atgcaggacttaggcgcgcatattccaaaaatggctgtcatgccgaatgatactggagat
ctcctaacactgcttgatgcgacgtatacaatgaaaacaatatatgcagaccgccccatt
attacaatgtcaatggctgcaacagggctcatcagcaggctgagcggtgaggtttttgga
tcggcttgtacttttggagctggagaagaggcgtccgcaccaggccaaattcctgtttct
gagctaaggagtgtcttagatattttgcataaaaacacacggggatag

DBGET integrated database retrieval system