KEGG   Bacillus subtilis subsp. subtilis 168: BSU23090
Entry
BSU23090          CDS       T00010                                 

Gene name
rsiX
Definition
(RefSeq) sigma-X negative effector
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Germane RskA T2SS-T3SS_pil_N RIC3 DUF4199 OATP
Other DBs
NCBI-GeneID: 938959
NCBI-ProteinID: NP_390190
Pasteur: BG10537
BSORF: BG10537
UniProt: P35166 A0A6M4JIX0
Position
complement(2413585..2414691)
AA seq 368 aa
MMKSEWNEEQIKELLSQLPAVKDHRSPQDIYKRLTMAKRKNKPAVRWIGPACAAAIAVYI
AFIISPHFFDQAQPQQKEASQENAVTKTETEDSPKAASSLDQTSFVVPEKEQDNYITVAV
ADADTSAIIPVSIQKTNADQTIQDMLFESSELGILDHAITIPTFIDEVEIKEKPKQKELS
IRVHQPATAFSIKDDTLLKKLLKESLKWSPYEKVKFLSDQNETGVRIGSYGTFTEISIPK
QSKRSYYLYQNKQGQDFLVPSNHSFDTVKEAIKEMESSSQEDTTPLIQAGAVQSVTKKQK
HLYIRFSKESEVDDSIAGILMIEGLLLTAKEFGFTEVTFTETRTKKIGKYDISDAIPVPA
APNPISLN
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgatgaagtcagaatggaacgaagaacagataaaggagttgttaagtcaacttccggca
gttaaagaccatcgttcgcctcaggatatttacaagcggctgacgatggcaaagcgtaaa
aataagcccgctgtcaggtggattggccccgcgtgtgccgctgcaattgcggtttatatc
gccttcattatttctcctcatttctttgatcaggcacagcctcaacaaaaagaagcgtcc
caagagaacgcagtaacgaaaactgagacagaagacagcccaaaagctgcatcgtccttg
gatcagacatcgtttgtcgttcctgaaaaggaacaagacaattacatcactgtagcggtt
gctgatgccgatacatctgcaatcatacccgtcagcattcaaaaaacaaatgcagaccaa
acgatccaggatatgctgtttgaaagtagtgaattgggcatccttgatcatgccattaca
attccaaccttcatagatgaagtagaaataaaggaaaaaccaaagcagaaggaattaagt
atacgagtccatcagccagctacggcattttctataaaagatgatacactgttaaaaaaa
ttgcttaaagaatccttaaaatggagtccttatgaaaaagtcaaatttttatcggatcaa
aatgagactggggttcggattggctcatatggcacttttacggaaatttcgattcccaaa
cagtcaaaacgatcctactacttgtaccaaaataaacaaggacaagactttctcgttccg
tcaaatcattcttttgatacagtaaaagaagcgattaaggaaatggaatcgagcagccaa
gaagatacgacacctcttattcaagcgggtgctgtccaatctgtaacgaagaaacagaaa
cacttatatatccgcttttcaaaggagtcagaagttgatgattctattgccggtatttta
atgattgagggactacttttgactgcaaaagagtttggcttcacagaagtgacctttacg
gaaaccagaacgaaaaaaatcggcaaatatgacatatcagatgcaattccggtgccagct
gctccaaatccgatttccttaaactaa

DBGET integrated database retrieval system