KEGG   Bacillus subtilis subsp. subtilis 168: BSU23100
Entry
BSU23100          CDS       T00010                                 

Gene name
sigX
Definition
(RefSeq) RNA polymerase sigma factor SigX
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU23100 (sigX)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU23100 (sigX)
SSDB
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4 Sigma70_ECF HTH_23 HTH_28
Other DBs
NCBI-GeneID: 938966
NCBI-ProteinID: NP_390191
Pasteur: BG10536
BSORF: BG10536
UniProt: P35165 A3F488
Position
complement(2414627..2415211)
AA seq 194 aa
MEETFQLLYDTYHQDLYQFLFYMVKDKNQTEDLLQEVYIRVLNSYHTFEGRSSEKTWLLS
IARHVAIDWFRKQQTIRQRILGTFDWDTQDVRDQQLLPDELAVQHENVREIYAALDQCTI
DQRAVIILRFIQGYSIQETAKALRFSESKVKTTQHRGLKVLRKHMELLREELMDDEVRME
RRTDKGVVKSTSGS
NT seq 585 nt   +upstreamnt  +downstreamnt
atggaagaaacctttcaattattatatgatacatatcatcaagatttgtaccaattttta
ttttatatggtaaaggataaaaaccagacagaagaccttcttcaagaggtttatatccgg
gtattaaattcttatcatacgtttgaaggaagaagcagtgaaaaaacatggcttttgtct
atcgcacgccatgttgcgatagactggttccgtaaacagcaaacaatcagacagcgtata
ctcggtacatttgactgggatacacaggatgtcagggatcagcaattgctgccggacgaa
cttgcggttcaacatgaaaatgtccgggaaatttatgctgcgcttgatcaatgtacaatc
gatcaaagagctgtgattatcttgcggtttattcagggatattcaatacaggaaacagcc
aaggctctgcgcttctcggaaagcaaagtaaaaacgacccaacacagagggctcaaagta
cttcggaaacatatggagcttttgagggaggagctaatggatgatgaagtcagaatggaa
cgaagaacagataaaggagttgttaagtcaacttccggcagttaa

DBGET integrated database retrieval system