KEGG   Bacillus subtilis subsp. subtilis 168: BSU23120
Entry
BSU23120          CDS       T00010                                 

Symbol
resD
Name
(RefSeq) transcriptional regulatory protein ResD
  KO
K07775  two-component system, OmpR family, response regulator ResD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU23120 (resD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU23120 (resD)
Two-component system [BR:bsu02022]
 OmpR family
  ResE-ResD (aerobic and anaerobic respiration)
   BSU23120 (resD)
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-GeneID: 938960
NCBI-ProteinID: NP_390193
Pasteur: BG10534
BSORF: BG10534
UniProt: P35163 A0A6M4JIR9
Position
complement(2417181..2417903)
AA seq 240 aa
MDQTNETKILVVDDEARIRRLLRMYLERENYAIDEAENGDEAIAKGLEANYDLILLDLMM
PGTDGIEVCRQIREKKATPIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKAL
LRRASQTSYFNANTPTKNVLVFSHLSIDHDAHRVTADGTEVSLTPKEYELLYFLAKTPDK
VYDREKLLKEVWQYEFFGDLRTVDTHVKRLREKLNKVSPEAAKKIVTVWGVGYKFEVGAE
NT seq 723 nt   +upstreamnt  +downstreamnt
atggaccaaacgaacgaaacaaaaatattagtagttgatgacgaagccagaattcgccgc
cttttaagaatgtatcttgaacgtgaaaattatgctatagatgaagctgaaaatggtgat
gaagccattgccaaagggcttgaagccaattatgacttaattttgcttgatctgatgatg
ccggggactgatggaattgaagtgtgccggcaaattcgtgaaaaaaaagcgacacccatt
attatgctgaccgcaaaaggagaagaagcaaaccgggtgcaggggtttgaagcgggaaca
gatgattatattgttaagccgttcagcccgagagaagtcgtgctgcgtgtaaaggccctt
ttgagaagagcatcccaaacctcttatttcaatgccaatacaccgacgaaaaatgtgctc
gtgttttcacatctgtcaatagaccatgatgctcaccgcgtaacagctgatggaacagaa
gtgagcctgacgccaaaagagtatgagcttctatatttcttagcgaaaacgcctgacaag
gtgtatgatcgggaaaagcttctgaaagaagtgtggcaatatgagttttttggtgattta
cggacagtggacactcacgtcaaacgcttgagagagaagctgaacaaggtatctccggaa
gctgcgaaaaaaattgtcaccgtatggggtgtaggttataaatttgaggtcggcgctgaa
tga

DBGET integrated database retrieval system