KEGG   Bacillus subtilis subsp. subtilis 168: BSU23130
Entry
BSU23130          CDS       T00010                                 

Gene name
resC
Definition
(RefSeq) cytochrome c biogenesis protein ResC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Cytochrom_C_asm DUF4173
Other DBs
NCBI-GeneID: 938962
NCBI-ProteinID: NP_390194
Pasteur: BG10533
BSORF: BG10533
UniProt: P35162 A0A6M3ZD81
Position
complement(2417984..2419159)
AA seq 391 aa
MAELSGNFLYAAFLVYLIAVPIFGGAIRGNKDKKGRPNRWANIGITLSIVGFFCHLGYFI
TRWAASGHAPVSNMFEFTTAFGMMLVLAFIILYFLYRLPSLGLFTLSIALLLIAYASMFP
TDISPLIPSLQSNWLYIHVTTAALGQAILAISFVAGVIFLLKHVDQTKPSKKTFWLEAIM
FILVTTVAFIAITSAFRLAGYEAEFNWVDKSKEKSVMVYEMPALVGPHQGELLTEGRMEP
LVDLPALFSGRKVNTVIWSFGAGLVLYGALRLIIRKRISALLHPLVKNVNLDLVDEVGYR
AVSIGFPIFTLGALIFAMIWAQLAWTRFWGWDPKEVWALITFLFYAAYLHLRLSRGWHGE
KSAWLAVIGFAIIMFNLIFVNLVLAGLHSYA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggcagagctgagcggaaattttctttatgcggcctttcttgtgtatttaatcgctgtc
ccaatcttcggcggggccatacgcgggaataaagataaaaagggcaggccaaaccgatgg
gccaacattggaatcaccctttctattgtcggttttttctgccacctaggatatttcatc
acaaggtgggctgcaagcggccatgcgcctgtcagcaatatgtttgaattcaccaccgct
tttggcatgatgcttgttttggcgtttatcattctttattttctctatagattgccttca
ttaggcctgtttacgctgtcaattgctttattgctgattgcctacgccagcatgtttccg
acagatatctcgcctttaattccttcgctccaaagtaactggctgtatattcacgtaaca
acggccgcgcttgggcaagctatacttgccatcagctttgtcgctggtgtcatctttctt
ttgaagcatgtagaccagacaaagccaagcaaaaagaccttctggcttgaagcgattatg
tttatcctggtcacaaccgtcgcctttattgcaatcacatcggcatttcgtcttgcaggc
tatgaagcggagtttaactgggtggacaaaagtaaagaaaaaagcgtgatggtgtacgaa
atgcccgcgcttgtcggtccgcatcagggagagcttttgaccgaaggaagaatggaaccg
cttgttgatcttcccgcgcttttctcaggcagaaaagtgaacactgtcatttggtcattt
ggagcaggtcttgtgttgtatggggctctccgtctgatcatcagaaaaagaatcagcgct
ctattacatccgctggtgaaaaacgtcaatcttgatctggtggatgaggttgggtacagg
gccgtatcaatcggatttccgatctttacactcggcgcgctgatctttgcaatgatttgg
gctcagctcgcgtggaccagattttggggctgggaccctaaggaagtatgggcgctgatc
acatttttgttctatgccgcttacttgcatttaagactgtcaagaggctggcacggtgag
aagtcagcatggctggccgtaatcggttttgctattattatgtttaatttaatattcgta
aatcttgtgcttgccggacttcattcttatgcatag

DBGET integrated database retrieval system