KEGG   Bacillus subtilis subsp. subtilis 168: BSU23140Help
Entry
BSU23140          CDS       T00010                                 

Gene name
resB
Definition
(RefSeq) cytochrome c biogenesis protein ResB
  KO
K07399  cytochrome c biogenesis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BSU23140 (resB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ResB DZR
Motif
Other DBs
NCBI-GeneID: 938961
NCBI-ProteinID: NP_390195
Pasteur: BG10532
BSORF: BG10532
UniProt: P35161
Position
complement(2419179..2420807)
Genome map
AA seq 542 aa AA seqDB search
MKQVKCECGHINPVGTVLCESCGRALQETQPPLADMRYDGSARRSQTYNKTIIDKIWNFF
SSVKVGIWLIVITLAASAFGTIFPQEAYLPPGAQADTYYKEQYGTFGQLYYLLGFHHLYG
SWWYLLLIASIGISLVICSLDRVIPLYRALKNQGVRRSPAFLRRQRLFSETVTVLNGESK
EKIVTLLKKKHYRIREKEGSILAEKGRFSRWGPYVNHIGLIIFLIGAMLRFVPGMYVDET
LWVREGETAAIPGTDGKYYLKNNQFSVETYNSKTEKKVFADAIDRVGDGRVAKNFQTDAV
LYKREGKIVYGEKPKLEKVTEEDIRVNQPLRFDSFSVYQVDYKENQLDQMVFQLIDKKTK
KSFGSLKINLLDPDSVYDLGNGYKVEIASYLPDFYFNQDGEPSTKTKIPNNPAFVFNIIT
PDKPKGEKSFVAIQETIEGSGNNKYKLKFDHVETKNITGLTVRKDLTLWVLAVGGAIFMI
GVIQGMYWQHRRIWLHSQDGAVMVAGHTNKNWFGLKKDLAFILADSGLTEPVDQKELIKT
QK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagtcaaatgtgaatgcggacatataaacccggtcggaaccgttttatgcgaa
tcgtgcggaagagctcttcaggaaactcaacctccgctcgctgatatgagatatgacgga
agcgcaagacgttcgcaaacctataacaaaacgatcatcgacaaaatttggaatttcttt
tcctcggttaaggtgggaatatggcttatcgtcataacccttgccgcatcagcgttcggc
accatttttccccaggaagcctatctgcctccgggcgcacaggctgatacttattacaag
gagcagtacggcacgtttggccagctttattatttgctcgggtttcatcatttatatggt
tcttggtggtatttgctgctcattgcctcgatcggcatttcactcgtgatttgcagcctt
gatcgggtcattccgttgtatagagcgttaaaaaaccaaggtgtcagaaggagcccggcc
tttttaagaaggcagcgcttgttcagtgaaacagttactgtactgaacggggaatcgaaa
gaaaagatagttactctattaaagaaaaaacattatagaatcagagaaaaagagggcagc
attcttgctgaaaaaggacgcttttcccgctggggcccgtatgtcaaccacattggattg
atcatctttctgattggtgcgatgctgagatttgtgcctggcatgtacgtcgatgagacg
ctttgggtcagagaaggcgaaaccgcagcaattccgggtacagacggaaaatattatttg
aaaaacaatcaattcagcgtagagacctataacagcaaaacggaaaaaaaggtatttgca
gatgccattgacagagtcggggacggtagagtggcaaagaactttcaaactgatgccgta
ctctacaagagagaaggaaaaattgtttatggcgagaagccgaagctggaaaaagtaaca
gaagaagacatccgtgtcaatcagccgctgcgttttgattctttttccgtttaccaggtg
gattacaaagagaatcagcttgaccaaatggtgttccagctgattgataaaaaaacaaaa
aaatcctttgggagcctgaagatcaaccttctggatccagattcagtctatgatcttggt
aacggttacaaggtggaaatcgccagctacctgcctgacttctattttaatcaggacgga
gagccgagcacaaaaacaaagatccctaacaatccggcttttgtctttaatatcataacg
ccggacaaaccgaaaggcgaaaagagctttgtcgccatccaagaaaccatcgaaggatca
ggcaataataaatacaagctgaaatttgaccatgtcgaaacgaaaaacattactggactt
acagtcagaaaggatctgacactctgggtgcttgctgtcggcggagccatttttatgatc
ggtgtcattcaaggtatgtactggcagcatcgaagaatttggctgcactcacaggacggt
gcagttatggtagcagggcataccaataaaaactggtttggcctgaagaaggatttagca
tttatattggctgattccggactgactgaaccggtggaccaaaaagaattaatcaaaaca
cagaaatag

DBGET integrated database retrieval system