KEGG   Bacillus subtilis subsp. subtilis 168: BSU23150
Entry
BSU23150          CDS       T00010                                 

Gene name
resA
Definition
(RefSeq) thiol-disulfide oxidoreductase ResA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AhpC-TSA Redoxin Thioredoxin_8 Thioredoxin Thioredoxin_2 SCO1-SenC AhpC-TSA_2 TraF GSHPx zf-trcl
Other DBs
NCBI-GeneID: 938958
NCBI-ProteinID: NP_390196
Pasteur: BG10531
BSORF: BG10531
UniProt: P35160 A0A6M4JLF1
Structure
PDB: 

Position
complement(2420804..2421343)
AA seq 179 aa
MKKKRRLFIRTGILLVLICALGYTIYNAVFAGKESISEGSDAPNFVLEDTNGKRIELSDL
KGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVN
FPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPGETSG
NT seq 540 nt   +upstreamnt  +downstreamnt
atgaagaaaaaaaggcgtttattcattcggaccggcatccttctcgttttaatctgcgca
ctcggctataccatttacaacgctgtatttgccggcaaagagagtatatccgaagggtcc
gacgcaccgaattttgtcctagaggatacgaatgggaaacgtatcgagctcagtgactta
aaagggaaaggtgtttttttgaatttctggggtacatggtgtgaaccgtgcaaaaaagag
tttccttatatggcaaaccaatataagcattttaaaagccaaggtgttgaaattgtcgct
gtaaatgttggggagtcaaagatagcagtacataattttatgaaatcctacggagtcaat
ttcccggttgttctggatacagatcgccaagtgcttgatgcctatgacgtatctccgctt
ccgacaacctttttgatcaatccggaaggaaaagttgtcaaggtggtgaccggcactatg
acagaaagcatgatacacgattatatgaatctcataaaacccggagagacttcgggatga

DBGET integrated database retrieval system