KEGG   Bacillus subtilis subsp. subtilis 168: BSU23160
Entry
BSU23160          CDS       T00010                                 

Symbol
rluB
Name
(RefSeq) ribosomal large subunit pseudouridine synthase B
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU23160 (rluB)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     BSU23160 (rluB)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSU23160 (rluB)
SSDB
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Other DBs
NCBI-GeneID: 938955
NCBI-ProteinID: NP_390197
Pasteur: BG10530
BSORF: BG10530
UniProt: P35159 A0A6M3ZDJ8
Position
complement(2421438..2422172)
AA seq 244 aa
MERLQKVIAHAGVASRRKAEELIKEGKVKVNGKVVTELGVKVTGSDQIEVNGLKVEREEP
VYFLLYKPRGVISAAQDDKGRKVVTDFFKNIPQRIYPIGRLDYDTSGLLLLTNDGEFANK
LMHPKYEIDKTYVAKVKGIPPKELLRKLERGIRLEEGKTAPAKAKLLSLDKKKQTSIIQL
TIHEGRNRQVRRMFEAIGHEVIKLKREEYAFLNLRGLHTGDARELTPHEVKRLRALADHG
KNAF
NT seq 735 nt   +upstreamnt  +downstreamnt
atggaaagactgcaaaaagtgattgctcatgccggagttgcgtcgcgcagaaaggcagaa
gagctgattaaagaaggaaaagtaaaggtgaatggcaaagtagtaacagagctaggtgtt
aaggtcaccggttctgatcagattgaggtaaacgggttaaaggttgaacgcgaagagccg
gtttactttctcttatataaaccaagaggcgttatttccgcagcgcaagatgataaagga
cgcaaagtggtgacggacttttttaaaaatattccgcagcgcatttatccgattgggcgt
ctggactatgatacgagcggtcttttgcttttaaccaatgacggcgaattcgccaataag
ctaatgcatcctaagtatgaaatagacaaaacatacgtggcgaaggtgaaaggaatcccg
cctaaagagctgctcagaaagctggagcgcggaattaggctggaggaaggcaaaacagcg
cctgctaaagcgaagctgctgtctttggataagaaaaagcagacaagcattattcagctg
acgatccatgagggacgcaacagacaagtgcgccgcatgtttgaagcgatcggacatgag
gtaatcaagctgaagcgtgaggaatacgcgtttttaaacctgcgaggcctgcacacgggc
gatgccagagagcttacgcctcacgaagtaaaaaggctcagagcactggcggatcacggt
aaaaacgctttctaa

DBGET integrated database retrieval system