KEGG   Bacillus subtilis subsp. subtilis 168: BSU23170
Entry
BSU23170          CDS       T00010                                 

Symbol
spmB
Name
(RefSeq) spore maturation protein B
  KO
K06374  spore maturation protein B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU23170 (spmB)
SSDB
Motif
Pfam: Gate
Other DBs
NCBI-GeneID: 938957
NCBI-ProteinID: NP_390198
Pasteur: BG10529
BSORF: BG10529
UniProt: P35158 A0A6M4JKC1
Position
complement(2422264..2422800)
AA seq 178 aa
MEIINWLSLAMIPIIIAGILLYGTIKKVPTYESFVEGGKEGIEIAFSIIPYLVGMLVAIT
VFRSSGALDFIMDLLKPAFSAIGIPAEVVPLALIRPISGTAALGMTTDLIAVYGPDSFIG
RLASVMQGSTDTTLYVLTVYFGAVGIKKMGDALKVGLLADLIGVVASIIIVTLLFGSA
NT seq 537 nt   +upstreamnt  +downstreamnt
atggaaatcatcaactggctgtctttagccatgattccaatcattattgccggaattctt
ctttatggaacgatcaaaaaggttccgacatatgaatcgtttgtcgaaggcgggaaagag
gggatagaaattgccttttccattatcccctatttagtcggaatgcttgtcgctataact
gttttcagatcatcaggcgcgcttgattttataatggatcttttaaaaccggctttctcc
gctatcggcatccctgctgaagtagtgccgcttgctctgatccgcccgatctccggtacg
gccgcacttggaatgacgaccgatttaattgcagtatacgggcccgattcctttatcggc
aggctggcttccgtcatgcagggatctacagatacaacgctttacgtactgactgtgtat
ttcggagcagtcggcattaaaaaaatgggtgatgcattaaaggtgggacttcttgcagat
ttaatcggcgtagttgcatctatcatcatcgttacgttattatttgggagcgcctga

DBGET integrated database retrieval system